KEGG   Mycobacterium intracellulare ATCC 13950: OCU_29810Help
Entry
OCU_29810         CDS       T02158                                 

Definition
(GenBank) putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    OCU_29810
Enzymes [BR:mia01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OCU_29810
DNA repair and recombination proteins [BR:mia03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OCU_29810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S Alpha_TIF
Motif
Other DBs
NCBI-ProteinID: AFC44200
UniProt: H8IQK1
LinkDB All DBs
Position
3170569..3171459
Genome map
AA seq 296 aa AA seqDB search
MARVDVEITHPDRVLFPADGITKRDLAAYYDQVADTMLAHLRGRALNVQRYPRGIAETGF
IQQDFADSLPDWMSSVRVAKEGGTVEHPVVERPEALRWLANQSCITLHMWQSRRARLDHP
DRLVFDLDPSDGDFAVVRATARATAGALGDLGLACYVQTTGSRGLHVVTPLRADTDFDTA
RQFARDVSEVVAADDPAHRTVEARKDKRDGRVYLDIMRNAYAQTAVAPYSVRARNGAPVA
TPLEWDELDAGRLRADRFTIRDVPKRLAGQPDPWAHMSRHARSLAGPLRRLARLRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgtcgacgtcgagatcacccacccggaccgcgttctgtttcccgccgacggg
atcaccaaacgcgatctcgccgcctactacgaccaggtggccgacaccatgctggcgcac
ctgcggggccgggccctcaacgtgcagcgctatccccgcggcatcgccgaaacagggttc
atccagcaggatttcgccgattcgctaccagactggatgagtagtgtccgggtggccaag
gagggcggtaccgtagagcatccggtcgtcgaacggccggaggcgctgcgctggctggcc
aatcaaagctgcatcaccctgcacatgtggcagtcgcgccgggcccggctggaccacccg
gaccggctcgtcttcgatctcgacccgtccgacggcgacttcgccgtggtgcgagcgacc
gcacgcgccaccgccggggcgctcggggacctgggcctggcgtgctacgtccagaccacc
ggctcgcgcgggctgcacgtggtgactcccttgcgcgccgacaccgatttcgacaccgcc
cggcagttcgcccgcgacgtcagcgaagtggtcgccgcggacgatcccgcgcatcgcacc
gtcgaggctcgcaaggacaagcgcgacgggcgggtatacctcgacatcatgcgaaacgcc
tacgcgcagacggcggttgcgccgtattcggtgcgggcccgcaacggcgcgccggtagcc
acaccgctggaatgggacgagctggacgccgggcggttgcgggccgaccggttcaccatt
cgagacgtgcccaaacggcttgccggacaaccggatccgtgggcgcacatgtcgcggcac
gcccgctcgctggccggcccgctgcggcgattggcgaggctacgtgcctga

DBGET integrated database retrieval system