KEGG   Mycobacterium intracellulare ATCC 13950: OCU_32960Help
Entry
OCU_32960         CDS       T02158                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00250  Alanine, aspartate and glutamate metabolism
mia00280  Valine, leucine and isoleucine degradation
mia00310  Lysine degradation
mia00410  beta-Alanine metabolism
mia00640  Propanoate metabolism
mia00650  Butanoate metabolism
mia01100  Metabolic pathways
mia01120  Microbial metabolism in diverse environments
Module
mia_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    OCU_32960
   00650 Butanoate metabolism
    OCU_32960
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCU_32960
   00280 Valine, leucine and isoleucine degradation
    OCU_32960
   00310 Lysine degradation
    OCU_32960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCU_32960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mia01007]
    OCU_32960
Enzymes [BR:mia01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     OCU_32960
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     OCU_32960
    2.6.1.48  5-aminovalerate transaminase
     OCU_32960
Amino acid related enzymes [BR:mia01007]
 Aminotransferase (transaminase)
  Class III
   OCU_32960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFC44515
UniProt: H8IU55
LinkDB All DBs
Position
3554326..3555669
Genome map
AA seq 447 aa AA seqDB search
MVAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLI
DLGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKR
SVLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAP
EVYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIV
PAEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPL
SAVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLL
RLQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLTVAAQAAGVIVLTCGMFGNII
RLLPPLTIGDELLAEGIDILSGLLRDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcg
ctggaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccg
gtcttcgtggctcgcgccggcggcggcatcatcgaggacgtcgacggcaaccggctcatc
gacctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgac
gcggtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgag
tcgtacgtcgcggtggccgagacgctcaaccggatcaccccgggctccggcgagaagcgc
tcggtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtggcgcgcgcc
tacacgcgcaagtcggcggtggtggcgttcaaccacgcctaccacggccgcaccaacctg
acgatggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccg
gaggtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctg
gccaccgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggc
gccgacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtg
ccggccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttc
atcgccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacac
gagggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctg
tcggcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcggcggc
accttcggcggcaaccccctggcctgcgcggcggcgttggccacgatcgagacgatcgag
agcgacgggctggtcgagcgggcccagcagctggagcggctgatcaccgaaccgctgctg
cggctgcaggccggcgacgaccggatcggcgacgtccgcggccgcggcgcgatgatcgcg
atcgagttggtgaagtcggggaccgccgagcccgacaaggagctgacccaaaagctgacc
gtcgccgcccaggcggccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatc
cggctgctgccgccgctgaccatcggcgacgagctgctggccgagggaatcgacatcctg
agcgggttgttgcgcgacctgtaa

DBGET integrated database retrieval system