KEGG   Mycobacterium intracellulare ATCC 13950: OCU_36540Help
Entry
OCU_36540         CDS       T02158                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00473  D-Alanine metabolism
mia00550  Peptidoglycan biosynthesis
mia01100  Metabolic pathways
mia01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    OCU_36540
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OCU_36540
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    OCU_36540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mia01011]
    OCU_36540
Enzymes [BR:mia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     OCU_36540
Peptidoglycan biosynthesis and degradation proteins [BR:mia01011]
 Precursor biosynthesis
  Amino acid ligase
   OCU_36540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFC44873
UniProt: H8II66
LinkDB All DBs
Position
complement(3885168..3886313)
Genome map
AA seq 381 aa AA seqDB search
MNASDRSTPHPGSGGGERARVAVVFGGRSNEHAISCVSAGSILRNLDPERFEVVAIGITP
EGSWVLTDGDPAALAITDRRLPEVTAESGTELALPADPRRGGQLVALPPGAGEVLASVDV
VFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLFAAEGLPVGDYAVL
RPSRARLRPEECQRLGLPVFVKPARGGSSIGVSRVASWDQLDAAVAAARRHDPKVIVEAA
IVGRELECGVLEMPDGTVEASALGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDD
EIADTVRQLAVRAFKAIDCQGLARVDFFLTEDGPVLNEINTMPGFTTISMYPRMWAASGV
DYPTLLATMVETALARGVGLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccagcgatcggtcgacgccgcaccccggctcggggggcggcgagcgggcgcgc
gtggccgtcgtcttcggggggcgcagcaacgagcacgccatctcgtgcgtctcggcgggc
agcattctgcgcaacctcgaccccgagcgtttcgaggtggtcgcgatcggcatcaccccg
gaaggttcctgggtgctcaccgacggcgacccggccgcgctggcgatcaccgaccggcgg
ctgcccgaagtcaccgccgagtcgggaaccgaactggcgctgccggccgatccgcggcgc
ggcggccaattggtcgccctgccgcccggcgccggtgaggtgttggcgtccgtcgacgtg
gtgttccccgtgctgcacggcccctacggcgaggacggcaccatccagggtctgctcgaa
ctcgccggcgtgccgtatgtgggcgccggtgtgctggccagcgccgccggcatggacaag
gagttcaccaagaagctgttcgccgccgagggattgccggtcggcgactacgcggtgctg
cgcccctcgcgcgcgcggctgcggcccgaggagtgccagcggctggggctgccggtgttc
gtcaaacccgcccggggaggttcctcgatcggtgtgagccgggtagcgagctgggaccag
ctggacgccgccgtcgccgcggcgcgccgccacgatcccaaagtcatcgtcgaggccgcg
atcgtcggccgcgagctggagtgcggtgtgctcgaaatgcccgacggcacagtcgaagcc
agcgcgctcggcgagatccgggtggcaggcgtgcggggccgcgaggattcgttctacgac
ttcgccaccaaataccttgacgacgcagccgaattggacgtgcccgcaaaggtcgacgac
gaaatcgccgacacagtgcgccaattggcggtccgcgccttcaaggccatcgactgccag
ggtctggcgcgggtggatttcttcctcaccgaggacgggccggtgctcaacgagatcaac
acgatgccggggttcaccacgatctcgatgtacccgcggatgtgggcggccagcggcgtg
gactacccgaccctgctggcgacgatggtcgagacggcgctggcccgcggggtgggcctg
cgctag

DBGET integrated database retrieval system