KEGG   Mycobacterium intracellulare ATCC 13950: OCU_39110Help
Entry
OCU_39110         CDS       T02158                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00380  Tryptophan metabolism
mia00630  Glyoxylate and dicarboxylate metabolism
mia01110  Biosynthesis of secondary metabolites
mia01130  Biosynthesis of antibiotics
mia01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCU_39110
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    OCU_39110
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     OCU_39110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI TetR_C_31
Motif
Other DBs
NCBI-ProteinID: AFC45130
UniProt: H8IM75
LinkDB All DBs
Position
4135703..4137805
Genome map
AA seq 700 aa AA seqDB search
MATDQNPKQRDLDSARFRRDTGYLTTQQGVRVDHTDDSLSVGDRGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDDALAQYTAARFLTTPGLQTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSA
HDTLWDFVALQPETLHTIMWLMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKP
RLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVPEEDEFSFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQGRSSYYKNTIGGGCPALADE
NVFRHYTQRLDGQTMRKRAESFENHYSQARMFWMSMTRVEAEHIVAAFAFELGKVEMPEI
RSAVVAQLARVDGELAAQVAAKLGLPAPPEEQVDTVTASPALSQVTDAGDTIESRKVAVL
AANGVDVVGTQRFIELMGQRGAVVEVLAPVAGGTLEGGSGGELPVDRSFTTMASVLYDAV
VVACGPRSIATLSNDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNRLAEDTDVLND
QSVITTKAAADELPDRFVEEFAGALAQHRCWQRRTDPVPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccagaatcccaagcagcgcgacctggactccgcacgcttccgtcgggac
accggatacctgacgacccagcagggcgtgcgcgtcgaccacaccgacgattcgctgtcg
gtcggtgaccggggaccgacgctgctggaggactttcacgcccgggagaagatcactcac
ttcgaccacgagcgcatcccggagcgcgtggtgcacgcgcggggcgccggcgcctacggc
tatttcgaaccgtacgacgacgcgttggcgcaatacaccgcggcgagattcttgaccact
ccaggcttgcagaccccggtgttcgtgcgattctccacggtggccggctcgcggggttcg
gccgacaccgtgcgcgacgtgcgcggcttcgccaccaagttctacaccgaacaaggcaat
tacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttcccc
gatttcgtgcacgcggtgaaaccggagccgcacaacgagattccgcaggcgcagtcggcc
cacgacacgctctgggacttcgtggcgctgcagcccgagacgctgcacaccatcatgtgg
ctgatgtcggaccgggcattgccgcgtagctaccggatgatgcagggcttcggcgtgcac
accttccggttggtaaacgaccgcggcgagggcactttcgtgaagttccactggaagccg
cggctcggcgtgcactctctgatctgggacgaatgccaaaagatcgccggcaaagacccc
gattacaaccgccgcgacctgtgggaggccatcgagtcgggccagtacccggagtgggag
ctcggcgtccagctcgtgcccgaggaggacgagttcagcttcgatttcgatcttctcgac
gcgacgaaaatcattcccgaggaacaggttccggtgcgcccggtgggcaagatggtgctc
aaccgcaacccggacaacttcttcgccgagaccgagcaggtcgcgttccacacggcgaac
gtggtgcccggcatcgacttcaccaacgatccgctgctgcagttccgcaacttctcctac
ctggacacccaactgatccggctgggcggccccaacttcgcccagctgccgatcaatcgg
ccggtggccgaggtccggaccaaccagcacgacggctacggacagcacgcgattccgcag
ggccgctccagctactacaagaacaccatcggcggcggctgcccagcgctggccgacgag
aacgtgttccggcactacacccagcggctcgacgggcagaccatgcgtaagcgggccgag
tccttcgagaatcactacagccaggcgcggatgttctggatgagcatgacgcgcgtggag
gccgaacacatcgtcgccgcgttcgctttcgagctcggcaaggtggagatgcccgagatc
cgttcggcggtggtggcacagctcgcgcgggtcgacggcgagttggccgcccaggtggcc
gcgaagctggggcttcccgcgccgcccgaggagcaggtcgacacggtgaccgcctcaccg
gcgctgtcacaggtcaccgacgccggcgacaccatcgaatcgcgcaaggtcgccgtgctg
gccgccaacggcgtcgatgtggtggggacacagcgctttatcgagctgatgggacagcgc
ggggccgtggtcgaggtgttggcgccggtggccggcggcacgctggagggcgggtccggc
ggcgaactgcccgttgaccggtccttcacgacgatggcgtcggtgctctacgacgcggtc
gtggtggcgtgcgggccgcggtcgatcgcgacgctgtccaacgacgggtatgcggtgcac
ttcgtgaccgaggcctacaagcatctcaagcccatcggggcgtacggcgccggcgtcgac
ctgctgcgcaccgccggtatcaccaaccgcctcgccgaggacaccgacgtgctcaacgac
cagtccgtcatcaccaccaaggccgccgccgacgagttgcccgatcgcttcgtcgaggaa
ttcgccggcgcgctcgcccaacaccgttgctggcaacggcgcaccgacccggttccggcc
tag

DBGET integrated database retrieval system