KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42370Help
Entry
OCU_42370         CDS       T02158                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00473  D-Alanine metabolism
mia01100  Metabolic pathways
mia01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    OCU_42370
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    OCU_42370
Enzymes [BR:mia01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     OCU_42370
Peptidoglycan biosynthesis and degradation proteins [BR:mia01011]
 Precursor biosynthesis
  Racemase
   OCU_42370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFC45456
UniProt: H8IQQ0
LinkDB All DBs
Position
complement(4468993..4470255)
Genome map
AA seq 420 aa AA seqDB search
MELLRRSRRNLANKSTLGGVRRGSGTMAPMTGRAATPISLTPGLLAEALVDLGAIAHNVR
LLCEQAGGAQVMAVVKADGYGHGAAQTARAALAAGAAELGVATVDEALALRADGVRAPVL
AWLHPPGFDFGPALLADVQIAVSSERQLDELLDAVRRTGRTATVTVKVDTGLNRNGVPPE
HYPSMLTALRRAVAENAIVLRGLMSHMVYADQPANPVNDLQAQRFTEMLAQARDQGVRYE
AAHLSNSSATMSRPDLAFDMVRPGIAVYGLSPVPERGDMGLIPAMTVKCPVALVKSIRAG
ESVSYGHTWTARRDTTLALLPVGYADGVFRSLGNRLEVLINGRRRPGVGRICMDQFVVDL
GPGPTDVAEGDEAILFGPGASGEPTAQDWADLLGTIHYEVVTSPRGRITRTYREARTIEP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggagttgttgcgccgatcacgccgaaatctcgccaacaagtccacgctcggcggcgtg
cggcgcggttctgggacaatggcgcccatgaccgggcgggccgctacgccgatatccctg
acaccgggcctcctcgccgaggccctggtggacctcggcgccatcgcgcacaacgtgcgg
ctgctgtgcgagcaggccggcggcgcgcaggtgatggccgtcgtcaaggccgacgggtac
ggccacggagccgcccagacggcgcgcgccgcgctggccgcgggggccgccgagctgggt
gtggccaccgtcgacgaagcgctggcgctgcgcgccgacggcgtccgcgcgccggtgctg
gcctggctgcacccacccggcttcgacttcgggcccgcgctgctggccgacgtccagatc
gccgtgtcgtcggagcgccagctcgacgagctgctcgacgccgtgcgccgcaccggccgg
accgcgacggtcaccgtcaaggtcgacaccgggctgaatcgcaacggcgtaccgccggag
cactacccgtcgatgctgaccgcgctccgccgcgccgtcgccgagaacgccatcgtgctg
cgcggcctgatgtcccacatggtgtacgcagaccaacccgccaacccggtcaacgacctt
caggcccaacggtttaccgagatgctcgcccaggcgcgcgatcagggggtgcggtacgag
gccgcgcacctgtcgaactcgtcggccacgatgtcgcggcccgacctcgccttcgacatg
gtgcgccccggcatcgcggtgtacggactgagcccggttcccgagcgcggcgacatggga
ctgattccggcgatgacagtgaaatgcccggtggcactggtgaagtcgattcgtgcgggc
gagagcgtgtcctacgggcacacctggaccgcgcggcgagacaccaccctcgcgctgctg
ccggtgggctatgccgacggcgtcttccggtccctgggcaaccgcctggaggtgttgatc
aacggccggcgccgaccgggggtcgggcggatctgcatggaccagttcgtcgtcgacctg
ggacccggccccaccgatgtcgccgagggcgacgaggcgatcctgttcggtcccggcgcg
agcggcgaacccaccgcgcaggattgggcggatctgctcggcaccatccactacgaagtg
gtgaccagcccccgcgggcggatcaccaggacctaccgcgaggcgcgaaccattgagccc
tga

DBGET integrated database retrieval system