KEGG   Mycobacterium intracellulare ATCC 13950: OCU_50090Help
Entry
OCU_50090         CDS       T02158                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00500  Starch and sucrose metabolism
mia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCU_50090
Enzymes [BR:mia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     OCU_50090
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     OCU_50090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AFC46228
UniProt: H8IJG9
LinkDB All DBs
Position
complement(5242977..5244758)
Genome map
AA seq 593 aa AA seqDB search
MDLMNDAKEAVEHHPEGGSHVQDGVVEHPDAEDFNNAAALPTDPTWFKHAVFYEVLVRAF
FDANADGAGDLRGLLGQLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVE
DFVALLNAAHERGIRVITDLVMNHTSDSHPWFQESRHDPDGPYGDYYVWSDTSERYTDAR
IIFIDTEESNWTFDPVRKQFYWHRFFSHQPDLNYENPAVQEAMIDVLRFWLGLGIDGFRL
DAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPADVVEYFGDPST
GGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPEIPDMAQWGIFLRNHDELTLEMV
TDEERDYMYSEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDE
IGMGDVIWLGDRDGVRTPMQWTPDRNAGFSKANPGRLYLPPSQDSVYGYQAVNVEAQRDT
STSLLNFTRTMLAVRRRHEAFAIGSFEELGGSNPSVLAFLRQVSGDGDTVLCVNNLSRFP
QPIELNLQHWSGRTPVELTGQVEFPRIGHLPYLLTLPGHGFYWFRLSGCEEDA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtggatttgatgaacgacgcaaaagaagctgtcgagcaccatcccgaagggggcagtcac
gtccaggacggcgtcgtcgagcaccccgacgccgaggacttcaacaacgccgccgcgcta
cccaccgacccgacctggttcaagcacgccgtgttctacgaggtgctggtgcgggcgttc
ttcgacgccaacgccgacggcgccggtgacctgcgcggactgctggggcagctggactac
ctgcaatggctgggcatcgactgcatctggctgcccccgttctacgactcgcccctgcgc
gacggcggttatgacatccgggacttctacaaggtgctgcccgagttcgggacggtcgag
gatttcgtcgcgctgctcaacgccgcgcacgagcggggcatccgcgtgatcaccgacctg
gtgatgaaccacacatcggattcgcatccctggttccaggagtcgcgccacgaccccgac
ggcccgtacggcgactactacgtgtggagcgacacgagcgagcgctacaccgacgcccgg
atcatcttcatcgacaccgaggagtccaactggaccttcgacccggtgcgcaagcagttc
tactggcaccgtttcttttcgcaccagccggacctgaactacgaaaacccggccgtgcag
gaagccatgatcgacgtgctgcggttctggctcggcctgggcatcgacgggttccggctg
gacgcggtgccctacctgttcgaacgggagggcaccaactgcgagaacctgccggagacg
cacgccttcctcaaacgcgtccgcaaggtcgtcgacgacgaattcccggggcgggtgctg
ttggccgaggccaaccagtggccggccgacgtcgtcgagtacttcggcgaccccagcacc
ggcggcgacgaatgccacatggcgttccacttcccgctgatgccgcgcatcttcatggcg
gtgcgccgggaatcccggttcccgatctcggagatcctggcccagacgcccgagatcccc
gacatggcgcagtgggggatcttcctgcgcaaccacgacgagttgacgttggaaatggtc
accgacgaagagcgcgactacatgtactcggagtacgccaaggatccgcggatgaaggcg
aacgtcggcatccgccgccgcctggccccactgctggacaacgaccgcaaccagatcgag
ctgttcaccgcgctgctgctgtcgctgcccggctcgccggtcctgtactacggtgacgag
atcggcatgggcgacgtgatctggttgggagaccgcgacggggtgcgcaccccgatgcag
tggacgccggaccgtaacgccggcttctccaaggccaatcccggccggctgtacctgccg
cccagccaggactccgtgtacggctatcaggcggtcaacgtggaggcccagcgcgacacg
tccacgtcgctgctcaacttcacccgcacgatgttggccgtgcggcgccgccacgaggcc
ttcgccatcgggagtttcgaggaactgggcggctcgaacccgtcggtgctggcgttcctg
cggcaggtgtccggcgacggcgacaccgtgctgtgcgtcaacaacctgtcgcggttcccg
cagccgatcgaactgaacctgcagcattggagcggacgcacgccggtcgagctgaccggg
caggtggagtttccgcgcatcggtcacctgccctacctgctgacactgccgggacacggg
ttctattggttccggctgagcggatgcgaggaggatgcatga

DBGET integrated database retrieval system