KEGG   Microcoleus sp. PCC 7113: Mic7113_1572Help
Entry
Mic7113_1572      CDS       T02374                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00010  Glycolysis / Gluconeogenesis
mic00053  Ascorbate and aldarate metabolism
mic00071  Fatty acid degradation
mic00280  Valine, leucine and isoleucine degradation
mic00310  Lysine degradation
mic00330  Arginine and proline metabolism
mic00340  Histidine metabolism
mic00380  Tryptophan metabolism
mic00410  beta-Alanine metabolism
mic00561  Glycerolipid metabolism
mic00620  Pyruvate metabolism
mic00625  Chloroalkane and chloroalkene degradation
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
mic01120  Microbial metabolism in diverse environments
mic01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_1572
   00053 Ascorbate and aldarate metabolism
    Mic7113_1572
   00620 Pyruvate metabolism
    Mic7113_1572
  Lipid metabolism
   00071 Fatty acid degradation
    Mic7113_1572
   00561 Glycerolipid metabolism
    Mic7113_1572
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mic7113_1572
   00310 Lysine degradation
    Mic7113_1572
   00330 Arginine and proline metabolism
    Mic7113_1572
   00340 Histidine metabolism
    Mic7113_1572
   00380 Tryptophan metabolism
    Mic7113_1572
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mic7113_1572
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mic7113_1572
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mic7113_1572
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Mic7113_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFZ17447
UniProt: K9WD37
LinkDB All DBs
Position
complement(1832501..1833874)
Genome map
AA seq 457 aa AA seqDB search
MLTQVPVKDIIRQQREFFATGKTKDVAWRIEQLKRLKQAVIDYQEAIVKAVKADLGRPDF
EAYFEITTIAEINYAIKHVKSWAKPKKVSTGIEQFPASAQVYPEPLGVVLIISPWNYPFQ
LMISPLTGAIAAGNCAVLKPSEMAANTSKVIADLIQNTFDPAYIAVVEGGVETSQQLLEE
KFDHIFFTGGTAIGKIVMQAAAKHLTPVTLELGGKSPCIVDADVDLKHAAKRITWGKYLN
AGQTCIAPDYLLVDRRIKSDLLTEIQKCAAEFYGDDPSQSPDYGRLISHRHFERLAPLLK
DGEIVMGGQTKPEEKYIAPTLIDGVSWDSPVMQEEIFGPILPVIEYTDLKEAIAQINAQP
KPLALYIFSKDKQKQQQVLQETSSGGVCINDTVMHVGISTLPFGGVGDSGIGSYHGKASF
DTFSHYKSVLKKGLWFDQNWRYPPYKGKLSLLKRIIG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctgactcaagtcccagtaaaagacatcatccgccagcaacgcgaattttttgctacg
ggcaaaacgaaggatgtggcatggcgcatcgaacagctcaaacgtctcaaacaagcggtc
attgattatcaagaagcaatcgtcaaggccgtcaaagctgacttggggcgaccggatttt
gaagcgtattttgagattaccacgatcgcagaaattaactatgccatcaaacatgttaaa
tcgtgggctaaacccaagaaagtctcgactggcatcgagcaatttcctgcctctgctcaa
gtttatcccgaacccttgggtgtggttctgattatctccccttggaattacccattccag
ttgatgatttctcctttaaccggagccattgccgctgggaactgtgctgtcctcaagccc
tctgagatggcggccaatacctctaaagtgattgctgatctgatccaaaatacctttgac
ccagcttatattgccgttgtggaaggtggcgttgagaccagtcaacaacttttagaggag
aaattcgatcatatctttttcacgggtgggacggcgatcggcaaaattgtgatgcaggca
gcggcgaaacatcttacccctgtaaccttggaattaggggggaaaagtccttgtattgtg
gatgcggatgttgacctcaaacatgcggcaaaacgcatcacttggggcaaatacctgaat
gcgggtcaaacctgtattgctccagactatctgttagtggatcgccggatcaaatccgac
ctattgacagaaattcaaaaatgtgcagcagagttttatggagatgacccgtctcaaagc
cccgactacggtcggctgattagccacagacattttgagcgacttgcacccctattaaag
gatggggaaatcgtcatgggcggacaaaccaagccagaggaaaagtatatcgctccaacg
ttgattgatggggtttcctgggactcgcccgtgatgcaagaagaaatttttggccccatt
ctacctgtgattgagtatacagacttgaaggaggcgatcgcacaaattaatgctcaacca
aagcccttagccctctatatcttctccaaagacaaacaaaagcagcagcaagtgttgcag
gaaacttcctctggcggcgtttgtatcaacgacaccgtgatgcacgtcggcatctcaacc
ctgccattcgggggtgttggggatagcggcatcggtagttatcacgggaaagccagtttt
gataccttttctcattacaaaagtgtgttaaagaaagggctttggttcgatcaaaattgg
cggtatcccccttacaaaggtaagctgtctctgctcaagcgaattattggttaa

DBGET integrated database retrieval system