KEGG   Microcoleus sp. PCC 7113: Mic7113_2170Help
Entry
Mic7113_2170      CDS       T02374                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00061  Fatty acid biosynthesis
mic00780  Biotin metabolism
mic01100  Metabolic pathways
mic01130  Biosynthesis of antibiotics
mic01212  Fatty acid metabolism
Module
mic_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mic7113_2170
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mic7113_2170
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mic7113_2170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mic01004]
    Mic7113_2170
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mic7113_2170
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mic7113_2170
Lipid biosynthesis proteins [BR:mic01004]
 Fatty acid synthase
  Component type
   Mic7113_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AFZ17985
UniProt: K9WC64
LinkDB All DBs
Position
2478675..2479451
Genome map
AA seq 258 aa AA seqDB search
MLNLTGKNALVTGIANNRSIAWGIAQQLHKAGANLGVTYLPDEKGRFEKKVKELVEPLAP
SIFLPCNVQDDAQIAATFEAIGQQWGKLDILIHCLAFAGKDALSGDFSNVSRADFTQALE
ISTYSLTQLAGAAKPLMTEGGSIVTLTYLGGVKVIPNYNVMGIAKAGLEMSVRYLAAELG
PNNIRVNAISAGPIRTLASSAVGGILDMIHHVEEVAPLRRTVTQMEVGNAAAFLCSDLSS
GVTGQVLYVDAGYEIMGM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatttgactggaaaaaacgctcttgtcaccggtattgccaataatcgctcgatc
gcttggggcattgcccagcaactgcacaaagcgggagcaaatttgggggttacctatctg
cccgatgaaaaaggacgttttgagaaaaaagtcaaagagctagtagaacccctcgcccct
agtatttttttgccctgtaacgttcaggacgatgcccaaatcgccgccaccttcgaggcg
atcggtcaacaatggggtaaattggacattctaattcattgccttgcctttgcgggtaaa
gatgcgttatcgggagactttagtaatgtttccagggctgattttacccaagcgttggaa
attagcacgtactcgctgactcaactggcaggggcggctaaacccttgatgacagaaggc
ggtagtattgtcaccctcacctatttggggggggttaaagtaattcccaattacaacgtg
atgggaattgccaaggcggggctggaaatgagtgtgcgttacctagcggctgaactaggg
ccgaacaatattcgggtgaatgcaatctcagcagggccgatccgtaccttagcctcgtca
gcggttggaggtatcctcgatatgattcatcatgtggaggaagtggcacccctgcggcgg
actgttacccagatggaagtgggtaatgcggcggctttcttgtgcagtgatttatccagt
ggtgtgacgggtcaagttttatatgtagacgccggttacgaaataatggggatgtaa

DBGET integrated database retrieval system