KEGG   Microcoleus sp. PCC 7113: Mic7113_2338Help
Entry
Mic7113_2338      CDS       T02374                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00630  Glyoxylate and dicarboxylate metabolism
mic00710  Carbon fixation in photosynthetic organisms
mic01100  Metabolic pathways
mic01120  Microbial metabolism in diverse environments
mic01200  Carbon metabolism
Module
mic_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mic_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mic_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mic7113_2338
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mic7113_2338
Enzymes [BR:mic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mic7113_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ18143
UniProt: K9WD54
LinkDB All DBs
Position
2676989..2677333
Genome map
AA seq 114 aa AA seqDB search
MQTLPKERRFETLSYLPPLTDSQIVKQVQYILDQGYIPAVEFSDNSEPEHHYWTLWKLPL
FKARSTQEVMAEVDACRSDYRDSYIRVVGFDNVKQCQVLSFIIHKPNTNARGRF
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttaccgaaagagcgtcgttttgaaaccctttcctacttgcccccgctgact
gattctcaaattgtcaagcaagttcaatacattttggatcaagggtatatccccgctgta
gaattcagcgacaattcagaaccagagcatcactactggacattgtggaagttacccctt
ttcaaagctcgcagcactcaagaagtgatggctgaagtggatgcttgccgttctgactat
cgcgactcttacatccgtgtggtgggttttgataatgtgaagcagtgccaagtgctgagc
ttcatcattcacaagcccaataccaatgctcgtggtcgcttctaa

DBGET integrated database retrieval system