KEGG   Microcoleus sp. PCC 7113: Mic7113_3187
Entry
Mic7113_3187      CDS       T02374                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00010  Glycolysis / Gluconeogenesis
mic00020  Citrate cycle (TCA cycle)
mic00620  Pyruvate metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
mic01120  Microbial metabolism in diverse environments
mic01200  Carbon metabolism
Module
mic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mic7113_3187
   00020 Citrate cycle (TCA cycle)
    Mic7113_3187
   00620 Pyruvate metabolism
    Mic7113_3187
Enzymes [BR:mic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mic7113_3187
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL PASTA
Other DBs
NCBI-ProteinID: AFZ18927
UniProt: K9WHB7
LinkDB
Position
complement(3657277..3658590)
AA seq 437 aa
MIHEVFMPALSSTMTEGKIVSWVKSPGDRVEKGETVVVVESDKADMDVESFYEGYLAVIT
VPAGESAPVGAAIALLAESEAEIEQVKQQAAQSSQGTAVSTPQKDSVPTPTPGQVEAAPV
AAQDTPSPRNGRIVASPRARKLAKELRVDLNSLKGSGPYGRVIAEDVEAAAGKGSTPAAT
PAATTTAPKPTSTPAPTTPAPRPAPTPAVPVAALGETVPFNTLQNAVVRNMVASLQVPTF
HVGYTITTDELDKLYKKIKTKGVTMTALLAKAVAVTLQKHPLVNASCVEQGIQYHSSINI
AVAVAMPGGGLITPVLQQADQVDIYSLSRNWKDLVERARLKQLQPEEYSSGTFTLSNLGM
FGVDRFDAILPPGQGSILAIGASRPSVVATEEGMMGVRRQMQVNITCDHRIIYGADAAAF
LQDLAKLIETDPQSLTL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgatccacgaagttttcatgcccgccctcagttccacaatgaccgaaggcaaaatagtc
tcttgggtaaaatctccaggggaccgagttgagaaaggcgaaacggtggtggtggttgag
tcagataaggcagatatggacgttgagtccttctatgaaggttatctggctgtgatcacg
gtaccggctggtgaatcagctcccgtaggggcggcgatcgcacttttggcagaatcggaa
gctgaaattgagcaagttaaacaacaagcggctcaatccagccagggtactgctgtttcc
acccctcaaaaagactcggtacccacaccgacgcctggacaagtagaggctgccccagtg
gcggctcaagatacacccagccctcgcaatggacggattgtcgcctcacctcgcgctcgc
aagttagccaaggaactccgcgtcgatctcaacagcctcaaaggcagtggcccctatggg
cgggttattgccgaggatgtggaagccgccgccgggaaagggagtactcctgccgctacg
cctgccgcgacgacaacagcaccgaaaccaacctcaacccccgcgccaactacccctgca
cctcgtccagcccccaccccagcggttcctgttgctgccttgggtgaaaccgtaccgttt
aatacgctgcaaaatgcggtggtacggaatatggttgccagccttcaggtgcctaccttc
cacgttggctataccattacaaccgatgagctggataagttatacaaaaaaatcaagacc
aaaggcgtgacgatgacggcactgctggctaaggccgtggcggttacgttacaaaaacat
cctttggtcaatgccagttgtgtagaacagggcattcagtatcacagttccatcaatatt
gccgtcgcggtggcaatgcctggtggaggactgattacgccggtcttacaacaagctgac
caagttgatatttattccctatctcgcaattggaaagacttggtagaacgtgccagactc
aagcagttgcagccggaggaatatagctctggtaccttcacgctgtccaatttgggcatg
tttggggttgaccgttttgatgctattttaccgccaggacaagggtcaattttggcgatc
ggggcatcacgtcctagcgttgtggcaacggaggagggaatgatgggtgtgcggcgtcag
atgcaggtgaatatcacttgtgaccaccggattatttacggtgctgatgcggcagcgttc
ctgcaagacttggcgaagttgattgaaaccgatccgcaatcgttaacgctttag

DBGET integrated database retrieval system