KEGG   Microcoleus sp. PCC 7113: Mic7113_3681Help
Entry
Mic7113_3681      CDS       T02374                                 

Definition
(GenBank) glycosyl hydrolase, glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00500  Starch and sucrose metabolism
mic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_3681
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Mic7113_3681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N
Motif
Other DBs
NCBI-ProteinID: AFZ19401
UniProt: K9WHW0
LinkDB All DBs
Position
4262605..4263393
Genome map
AA seq 262 aa AA seqDB search
MKKFNWLGIVFITIVVIIFTLTHQIFFPVGLKGVEAFGHPGICPTWSPANLTVLGTAANP
TSQVWFTGFDGILGEVFYPEVDTPATVDWQFLVGDANHTWVDEEKRDTTHQVTLNNLHSL
SWTITNTAKNRLDQIQKTIFTDPNRNTLIQQVTFTALKGTLRDFHLYTLYHPALDNQGRS
TTGYSTTYNKQKKLVAKNSTQGHVSALVQEGSSRSVLRRSRKKAEGKDACTLSFLTFLNG
LRRMTIYFGFLKAVKIPYEQSP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaatttaattggttgggaattgtcttcattactattgtggtgattatattcacc
ctgacccatcaaatttttttcccagttggtctcaagggtgttgaagcctttggtcatcca
gggatttgtccaacttggtcgcccgcaaatctcaccgtccttggcactgccgctaatccc
acttcccaagtttggtttacaggttttgacggcatcctcggagaggtattttaccctgaa
gtagacacaccagctacagtagactggcaatttttagtaggggatgcgaatcatacctgg
gttgatgaagaaaagcgggatactactcatcaggttactttaaataatttacattcgctc
tcttggactatcacgaatacggctaaaaatcgcctggaccaaattcaaaaaacaattttt
accgaccccaaccgtaatactttaatccagcaggtaaccttcactgccttaaagggtacg
ttgagagatttccacctttatactctgtatcatcctgctctggataatcagggacgctcc
actacaggttacagcacgacctacaacaaacaaaagaagctggttgcgaaaaactcaact
cagggtcatgtttctgcactagtgcaagaaggcagttcgcgtagcgttctccgtaggagt
agaaagaaggcagaaggtaaggacgcttgtacactaagctttttaacctttttgaacgga
ttaaggaggatgacaatctactttggattccttaaagccgttaagattccttatgaacaa
tcaccctaa

DBGET integrated database retrieval system