KEGG   Microcoleus sp. PCC 7113: Mic7113_3792Help
Entry
Mic7113_3792      CDS       T02374                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mic  Microcoleus sp. PCC 7113
Brite
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mic7113_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: AFZ19510
UniProt: K9WGH8
LinkDB All DBs
Position
complement(4400917..4401669)
Genome map
AA seq 250 aa AA seqDB search
MALNRRNFLVLLGATTGTLALANIACAAEPAAKPTSDNKQNQAGTETFKLPPLPYAYNAL
EPHIDEATMQFHHDKHHAAYVKNLNDAVNKYPQLKGKSPEDLLRNLSSVPEDIRTTVRNN
GGGHVNHTMFWEIMGPNGGGEPKGAIAKAITDSFGSFDKFKQQFNEAGTKRFGSGWAWLV
RSKDGKLQVMSTANQDSPLMEGSFPIMGNDVWEHAYYLKYQNKRADYLTAWWNVINWDEV
NKRYEQAMKS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctcttaatcgtcgcaattttctcgtgttactcggtgccactacagggacattggct
ttggccaatattgcctgtgccgctgaacctgcggcaaaaccgacctcagacaataagcag
aatcaggcaggtacagagactttcaaactaccccctctaccttatgcttacaatgccctg
gaaccccatatcgacgaagcaaccatgcagtttcatcatgacaagcaccatgcggcttat
gtgaaaaacttgaatgacgctgtcaataagtacccacaactcaaagggaagagtcctgaa
gacttgctgcgtaacctgagtagtgtgccggaagatattcggacaacggtacgcaacaac
ggtgggggtcatgtgaatcacaccatgttctgggaaattatggggccgaatggtggtgga
gaacccaaaggtgcgatcgctaaagccattacagattctttcggcagcttcgataaattt
aagcagcaatttaatgaagccggaaccaagcgtttcggcagtggatgggcttggctagtt
cgttctaaagatggcaagctgcaagtaatgagtacggcgaatcaagacagtcctctcatg
gagggcagctttccgattatgggtaacgatgtttgggaacatgcttactatctgaaatac
caaaataagcgtgctgattacttaaccgcttggtggaatgtcattaactgggatgaagtg
aacaaacgctatgagcaagcgatgaaatcttaa

DBGET integrated database retrieval system