KEGG   Microcoleus sp. PCC 7113: Mic7113_4177Help
Entry
Mic7113_4177      CDS       T02374                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00500  Starch and sucrose metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_4177
Enzymes [BR:mic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Mic7113_4177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AFZ19878
UniProt: K9WI49
LinkDB All DBs
Position
4884599..4887178
Genome map
AA seq 859 aa AA seqDB search
MELCRFMQPIRTFNVSPSLPKPLEPLRKLAYNLHWDWNVETKDLFRRLDRDLWESSRHNP
VLMLGTISQARLQEVAEDEGFLAQMERASRQLDDYLKERTWYRKHRDKGEKTECYAYFCA
EYGLTDCLPIYSGGLGVLAGDHLKSASDLGLPLVAVGLLYQEGYFAQYLNADGWQQERYP
INDFYNMPLHLERKADGSELRIEVDYPGRTVYARVWRVQVGTVPLYLLDTNIEPNNPYDH
DITDELYGGDLDMRIHQEMMLGIGGMRALQALGYKPTVYHLNEGHSAFLILERIRKLMQE
EGLSFHEAKQVAQSTQIFTTHTPVSAGFDLFPPDKAMYYVGHYANIFGLSREEFLGLGRE
NPADLASPFSMAALALKTASYTNGVSALHGEVSRVMFQGLWPNLPLPEVPITSITNGVHA
RSVVAKPTQELYDRYLGPSWSDKGADDPLWERVNSIPDEELWRNHERQRSELVVYVRERM
LKHLRDRGAPPTELAQVHEVLDPSVLTIGFARRFATYKRANLFMRDMERIKKIMRANKDR
QVQFVIAGKAHPKDMPGKELIRQIIRQVREAGIGDHVVFVPDYDIYLARMMVAGCDVWLN
TPRRPREASGTSGMKGAMNGLPNLSILDGWWDEADYVRTGWPIGHGETYDDPEYEDQIEA
NALYELFEEEVVPLFYNRDSEGIPRGWVAKMKDAIRFNTPVFNTARMLRDYAINGYFPAS
NRHFAMTSDTYKPAKELASWKRQLFERWYDIKIEDVDIAAPADLMVNQSVAVKTRINLAG
LSADDVQVELYQGAINTDGQIMNGLPVVMEYQGTDESHRSIYTGDVVYGASGLQGLSLRV
LPKHDYLSSPYELGLVLWA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
ttggaactttgtcgctttatgcagccaattcgcacgtttaacgtctctccttccttaccg
aagccactggaacccttacggaagctggcttacaacctccactgggattggaatgtcgag
accaaagatttattccgacgtttagaccgcgatttgtgggagtccagccgccacaaccct
gtcttgatgctgggcaccatcagccaagcgcggcttcaggaagtcgcagaagatgaagga
tttctggcccaaatggagcgagcttctcgacagctggacgactacctcaaagagcggaca
tggtaccgcaaacatcgcgacaaaggagagaaaactgaatgttatgcctacttctgtgct
gagtatggtctgacggattgtctacccatctattcaggtggcttgggtgtcctagcggga
gaccacctcaagtcagcctctgacctaggtttacctttggtagcggttggtttgctttac
caggaaggctattttgcccagtaccttaatgccgatggttggcagcaggaacgctatccg
atcaacgatttctacaatatgccgctccacctagagcggaaggccgatggttcagagctg
cggatcgaagtagactatccaggccgtactgtctatgcccgtgtctggcgagtacaggtg
ggaaccgtacccttgtacctccttgatacgaatattgagccgaacaatccctacgaccac
gacatcaccgatgagttgtatggtggcgacctggatatgcggattcaccaggagatgatg
ttagggattggggggatgcgtgccctacaagcgttgggatacaagccaacggtctatcat
ctcaacgaaggtcactcggcctttttgattctagagcgcatccggaagctgatgcaggaa
gaagggctgagcttccatgaagcaaagcaggttgctcaatcaacgcaaatttttacgact
catacaccggtctctgctgggtttgacctgtttccccccgataaggccatgtactatgtg
ggtcactatgccaacatttttggcttatcgagagaggaatttctcggtttaggacgggag
aacccagcggatctggcatctccctttagtatggcggcattagcgctgaagacagccagt
tataccaatggggtgagcgcgctgcatggagaagtatcacgggtgatgttccaagggctg
tggccgaacctgccactgccggaagtgccgattacatcgattaccaacggggtacatgct
cgcagcgtggtggcgaagccgacgcaggaactgtatgaccgttacctagggccaagctgg
tcggataaaggagccgatgaccctttgtgggagcgggtgaattcaattcctgatgaggag
ttgtggcgcaatcacgagcggcagcgctcggagttagttgtgtatgtacgggagcggatg
ctcaagcatttacgcgatcgcggggcacccccaacagaactggctcaagtccacgaagtt
ctcgatcccagcgttttgaccattggctttgcccgtcggtttgccacttacaaacgagcc
aacctgttcatgcgcgacatggagcggattaagaaaatcatgagggctaataaagaccga
caagtccagtttgtgattgccggtaaagcccacccgaaagacatgccagggaaagaacta
atccgccaaatcatccgccaggttcgtgaagcggggattggggatcatgttgtctttgtc
cctgactacgacatttatctggcgcggatgatggtagccggttgcgatgtttggttgaac
acgcctcgtcgccccagagaagcctctggaacttctggaatgaaaggggcgatgaatggt
ctacccaatctcagcattctcgatggatggtgggatgaagcggattacgtccgcaccggc
tggccgattggtcatggggaaacctatgatgaccccgaatacgaagatcagatcgaagcc
aacgctctgtacgaattgttcgaggaagaggttgtccccttgttctacaatcgtgacagc
gagggaattcccagagggtgggtggcaaaaatgaaagatgccatccggttcaataccccg
gtcttcaacacggcacggatgctgcgggattacgccataaacggctatttcccagccagt
aatcgccattttgccatgacgagcgacacctacaagccagcgaaagagctagcgagttgg
aagcggcagctatttgaacgctggtacgacatcaaaattgaagatgttgatatcgccgcc
cccgccgacttgatggtcaaccaatcggttgccgtcaaaacccggattaatttggccgga
ctgagtgctgatgatgtccaagtggaactctatcaaggagccatcaacaccgatgggcaa
attatgaacggtctaccggtcgtgatggaatatcaaggcactgacgaaagccaccgtagt
atttatacgggtgatgtggtttacggtgcgagtgggttacagggtttgtccctgcgggtg
ttgcctaaacatgactatctttctagcccctatgagctaggtttagtcctctgggcttag

DBGET integrated database retrieval system