KEGG   Microcoleus sp. PCC 7113: Mic7113_4658Help
Entry
Mic7113_4658      CDS       T02374                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00500  Starch and sucrose metabolism
mic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_4658
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mic7113_4658
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Mic7113_4658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AFZ20331
UniProt: K9WKJ2
LinkDB All DBs
Position
5452331..5453965
Genome map
AA seq 544 aa AA seqDB search
MKNLWYKDAIIYSLDVETFMDVNGNGIGDFIGLTKRLNHLAGLGVTCLWLLPFYPSPNRD
NGYDIMDYYNVDPRLGTLGDFVEFMHQARDRGIRLIIDLVVNHTSNQHPWFQSARSDKNS
KYRDYYVWTDNPPKDAQDKVAFPGVQESIWEYDEQAGAYYLHRFYKEQPDLNTANPEVRE
EIRKIMGFWLELGVSGFRIDAAPFLIEPLGMENAKREELHNLLSDMREFVSERRGDGVLL
AEANVSPDQIPLYFGDGDRMNMLFNFLLNQYIFLALAREQAAPIIEGLKTLPDTPHTGQW
VNFLRHHDELTLDGLTKDEQQEIFAAFAPDETMQIYGHGIRRRLAPMLGGDRHRLELAYS
LLFSLPGTPLLRYGDEIGMGDDLSLEGRTSVRTPMQWSNTQNGGFSTAPQDALTRPVISE
GEYGYQQVNATTEQRDPNSLLNWMERVIRIRQQCPELGRGKWCILETDEPSVFAHCCEWE
GNTVLTVHNLAKQPCTVTLKLKDFKPKHLMELFANRQYEPFDGNSSSIEVDAYGYRWFRS
DSVL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctctggtacaaagacgcaattatctactccttagatgtggagacatttatg
gatgtcaacggcaatggcatcggtgactttatcggactcaccaaacgcctgaaccacctg
gctggattgggagttacctgcctgtggctattgccgttctacccctccccaaaccgagac
aacggctacgacatcatggactattacaacgttgacccgcgtctgggaactctgggagac
tttgtggagttcatgcatcaggctcgcgatcgcggcattcgtctgatcattgaccttgtg
gtcaatcacacctcaaatcaacatccgtggttccagtccgcccgctctgacaaaaactcg
aagtatcgcgactactacgtatggacagataatccccccaaagacgctcaagacaaggtg
gcttttcccggtgtgcaggagagtatctgggaatatgatgaacaagctggcgcatactat
ttgcaccgattctataaggaacagccagacttaaatactgccaatccagaggtgcgtgag
gagattcgcaagattatgggtttctggctggaacttggcgtatccggctttcgcatagac
gctgccccattcctaatcgagccactgggtatggagaatgccaaacgtgaggaactccac
aaccttctgtctgacatgcgagaatttgtttcggaacgacgtggcgatggcgtgttgcta
gcagaggcgaacgtctcgcctgaccaaatccccctttactttggagatggggacaggatg
aatatgctattcaactttttgttgaaccagtatatcttcctcgcgttggctagggagcag
gcagcccccatcattgagggattgaaaacactgcccgataccccacatacaggacagtgg
gtgaactttctgcgtcaccacgatgaacttacccttgatggcctcaccaaggacgaacag
caagagattttcgccgcttttgcacccgatgagacgatgcaaatttacgggcatggcatc
cgccgtcgtctggcacccatgctcggaggcgatcgccatcgcctagagttggcgtatagc
ctgctatttagcttgcccggtacacccctgctgcgctatggcgatgagattggtatgggc
gatgatttatcgcttgaaggtcgtaccagcgtccgcacgcctatgcaatggtcaaacact
caaaatggaggcttctccacagcgcctcaagatgcactcacacgacccgtgatttcagaa
ggggagtacggctatcagcaggtcaatgccactaccgagcagcgtgacccgaactcattg
ctcaactggatggagcgggtgattcgcatacgccagcaatgcccagagttgggtcggggg
aagtggtgcattttggaaacggatgagccaagtgtatttgcccactgttgcgagtgggag
ggtaacactgtactgaccgtgcataatctggcaaagcaaccttgtacggtcacccttaaa
ttgaaggacttcaagccaaagcacctaatggagctgtttgcaaatcggcagtacgaaccc
tttgacggcaattcaagttctatcgaagtggacgcatacgggtatcgctggttccgctcc
gatagtgtgctttaa

DBGET integrated database retrieval system