KEGG   Microcoleus sp. PCC 7113: Mic7113_4919Help
Entry
Mic7113_4919      CDS       T02374                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00500  Starch and sucrose metabolism
mic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mic7113_4919
Enzymes [BR:mic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mic7113_4919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AFZ20581
UniProt: K9WLB4
LinkDB All DBs
Position
5755580..5757043
Genome map
AA seq 487 aa AA seqDB search
MADVNGTMMQYFHWYIPADGTLWEEVKNKAADLAQAGFTALWLPPAYKGQGGGYDVGYGV
YDLFDLGEFAQKNTVRTKYGTREQLLAAVKAVQNAGMQAYADVVLNHKDGGDNPETVKAL
PFSTDNRNYPSGDWQQIEIYTNFTFPGRGSKHSSMEWHWWHFDAVNHRKDRLGDNSTVYL
LEGKNFDNFVDLEKGNYSFLMACDLDMEHEQVQGELKYWGEWFLDTTGVDGFRLDAIKHI
PSWFYKDWLNHVRHHAQQNLFTVGEYWSDNIAALHWYISATEGKMSLFDVPLHYNFHRAS
KLGGYYDMRNILNGTLMQQQPALAVTFVENHDSQPLQSLESVVESWFKPLAYAIILLRRE
GYPCVFYADYYGAHYKDKGYEIWLDSHRWLIDKFLHARQNYAYGNQYDYFDDQNIIGWTR
LGNPEHPKAMAVLMSDGPAGSKWMEVGKRSAIFHDLTEHIKEPVHTNGDGWGEFRCNGGS
VSVWLEQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtgaatggcacgatgatgcagtatttccactggtacatcccagccgatggc
accttgtgggaggaagttaaaaacaaagcggcagacttggctcaagctggctttacagcc
ttatggttaccacccgcgtacaagggtcaaggcggtgggtatgatgtcggttatggggtt
tacgatctcttcgatttaggtgaatttgctcagaaaaatacagtacgcacgaagtacggc
acacgagagcagttgcttgccgccgtaaaagcggtacagaatgctgggatgcaagcctac
gcagatgtagttctcaatcacaaagacggcggagataaccctgaaacggtcaaagcgtta
cccttcagcacggataaccgtaattatccatcaggtgattggcaacagattgagatttac
accaactttacctttcctgggcgtggcagcaaacactccagtatggaatggcactggtgg
cactttgatgcagtgaaccaccgtaaggatcgcttaggggacaatagtacggtttacctc
ttagagggcaaaaactttgataacttcgtcgatttggagaaaggcaattactccttcctc
atggcttgcgacttggatatggaacatgagcaagtgcagggcgaacttaagtattggggc
gagtggttcttagatacaacgggtgtcgatggcttccgacttgatgcgattaagcatatc
ccatcctggttttataaagactggctcaatcatgtgcgtcaccatgcacagcagaattta
tttaccgtgggtgaatactggtcagacaacattgccgccttgcactggtatattagtgcg
actgagggaaagatgtcgctgtttgatgtgccactgcattacaacttccatcgcgctagt
aagctgggtggatactacgatatgcggaacatcttgaacggcaccctgatgcagcagcaa
ccggcactcgcggttacctttgtggaaaaccatgatagtcagccgttgcaatcgctggaa
tctgtggttgagtcatggttcaagccgttggcgtatgccatcatcctgctgcgtcgggag
ggctacccctgcgtgttctatgccgattattacggagcacattacaaagataaggggtat
gaaatctggctggattcccatcgctggctaatcgacaagtttttacatgcccgccaaaac
tatgcctatggtaatcagtatgactacttcgacgatcaaaacatcatcggctggacgcgc
ttaggcaatccagagcatcctaaagccatggcggtactgatgagtgatggcccagccggt
agcaagtggatggaggtcggtaagcgtagtgcaatcttccatgacctaactgagcatatc
aaagaacctgtacacaccaatggtgatggttggggtgagttccgctgcaacggtggctca
gtttcagtatggcttgaacaatag

DBGET integrated database retrieval system