KEGG   Micromonospora sp. B006: MicB006_0496Help
Entry
MicB006_0496      CDS       T05583                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
micb  Micromonospora sp. B006
Pathway
micb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:micb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MicB006_0496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:micb03400]
    MicB006_0496
Enzymes [BR:micb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MicB006_0496
DNA repair and recombination proteins [BR:micb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MicB006_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AXO32803
LinkDB All DBs
Position
497372..498310
Genome map
AA seq 312 aa AA seqDB search
MPGAPLKPMLATTGQLPAGAAWAYEFKWDGVRALADISRGDRHFYARSGVEITTAYPELL
NLAEQVGDALLDGEVVLFTDGQPSFTALAERMHVRNPAKAARLAATVPVTYMIFDLLRLD
GEDLTARPWRERRAALEALGLGAARWAVPPVFGDGPATYAAAGEHGLEGVMAKRVDSLYR
PGVRSPDWVKVKLEVTGDFVVGGWRPGARRVGGLLVGVPGPDGRLIYRGRVGGGIGAAIE
RELLRELEPLRATASPFAAGVPREDARGAIWVSPRIVVEVKYGQRTPDGRLRFPRILRLR
PDKPPEEVDDAG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcgcgccgttgaagccgatgctcgcgacgaccgggcagctcccggccggcgcc
gcctgggcgtacgagttcaagtgggacggggtccgcgcgctcgccgacatctcacgcggc
gaccggcacttctacgcccgctccggcgtcgagatcaccaccgcgtacccggaactgctc
aacctggccgagcaggtcggcgacgcgctgctcgacggcgaggtggtgctcttcaccgac
gggcagccctcgttcaccgcgctcgccgagcggatgcacgtgcgcaacccggccaaggcg
gcgcggctcgcggcgaccgtacccgtcacgtacatgatcttcgacctgttgcggctcgac
ggcgaggacctgaccgcccggccgtggcgggagcggcgggcggcgctggaggcgctcggg
ctcggcgccgcccggtgggcggtgccgccggtcttcggcgacggcccggccacctacgcg
gcggccggcgagcacgggctggagggggtgatggccaagcgggtcgactcgctctaccgg
cccggcgtgcgctccccggactgggtgaaggtcaagctggaggtcaccggcgacttcgtg
gtcggcggctggcggcccggcgcgcgccgcgtcggcggcctgctggtcggcgtgcccggc
ccggacgggcggctgatctaccgggggcgggtcggcggcgggatcggcgcggccatcgaa
cgggaactgctgcgcgagctggaaccgctgcgggccaccgcgtcgccgttcgccgccggg
gtgccgcgcgaggatgcccgcggcgcgatctgggtaagtccccggatcgtggtggaggtc
aagtacggccagcgcacgccggacggccggctgcgcttcccgcgcatcctgcgcctgcgc
ccggacaagccgcccgaggaggtcgacgatgccggctga

DBGET integrated database retrieval system