KEGG   Micromonospora sp. B006: MicB006_1297Help
Entry
MicB006_1297      CDS       T05583                                 

Definition
(GenBank) aspartyl-tRNA(Asn) amidotransferase subunit A/glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
micb  Micromonospora sp. B006
Pathway
micb00970  Aminoacyl-tRNA biosynthesis
micb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:micb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MicB006_1297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:micb03029]
    MicB006_1297
Enzymes [BR:micb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MicB006_1297
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MicB006_1297
Mitochondrial biogenesis [BR:micb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MicB006_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXO33595
UniProt: A0A385ANK1
LinkDB All DBs
Position
1310199..1311674
Genome map
AA seq 491 aa AA seqDB search
MSDLTKLSAVEIAGLVASGETSAVEVTQAHLDRIGAVDDRVHAFLHVDTEGALAAARSVD
ERRAAGEELGPLAGVPVAVKDVLTTKGVPTTVGSKILEGWRPPYDSTIVERLRAAGTVML
GKTNMDEFAMGSSTEYSAYGPTRNPWDLERIPGGSGGGSAAALAAYEAPLSIGSDTGGSI
RQPGAVTGTVGAKPTYGGTSRYGLVAFSSSLDTPGPCARTVLDAALLHEVIGGHDPRDST
SIPAAVPDVVAAARLGATGDLTGVKLGMVTEFTGEGAEPGVSAAFRDAAEALAKLGAEIV
EVSCPHFKYALPAYYLIAPSECSSNLARFDGVRFGLRVGDDGNRSLEEVMSLTREAGFGP
EVKRRIMIGTYALSSGYYDAYYGQAQKVRTLITRDFTSAFEQVDALISPTTPFVAFPLGS
RTADPYQMYLADLFTIPTNLYGGPAISVPCGLSDGLPVGFQIMAPTMADDRMYRVAAALE
SAVGTLTPPTL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttgaccaagctgagtgccgttgagatcgccgggctggtggcgagcggcgag
acctccgccgtcgaggtcacccaggcccacctggaccgcatcggcgccgtcgacgaccgg
gtgcacgcgttcctgcacgtcgacaccgagggggcgctcgccgccgcccggtccgtggac
gagcgccgcgcggccggcgaggaactcggcccgctcgccggtgtgccggtagcggtgaag
gacgtgctcaccaccaagggcgtgccgaccaccgtcgggtcgaagatcctggagggctgg
cgcccgccgtacgactcgacgatcgtcgagcggctgcgcgccgccggcacggtgatgctc
ggcaagacgaacatggacgagttcgccatgggctcctccaccgagtactcggcgtacggg
ccgacccgcaacccgtgggacctggagcggatcccgggcggttccggcggcggcagcgcg
gcggcgctggccgcgtacgaggcgccgctgtcgatcggctcggacaccggcggctcgatc
cgccagccgggcgcggtcaccggcaccgtcggcgcgaagccgacctacggcggcacctcc
cgctacggcctggtggcgttctcctcgtcgctggacacgcccggcccgtgcgcgcgtacc
gtgctggacgccgcgttgctgcacgaggtgatcggcggccacgacccgcgtgactccacc
tcgatcccggccgcggtgccggacgtggtggccgccgcgcgcctcggcgccaccggcgac
ctgaccggcgtgaagctcggcatggtcaccgagttcaccggcgagggcgcggagccgggc
gtgtcggccgcgttccgcgacgcggccgaggcgctggcgaagctgggcgcggagatcgtg
gaggtctcctgcccgcacttcaagtacgcgctgccggcctactacctgatcgcgccgagc
gagtgctcctccaacctggcccggttcgacggcgtccggttcggcctgcgggtcggcgac
gacggcaaccggtcgctggaggaggtcatgtcgctgacccgcgaggccggcttcggcccc
gaggtcaagcgccgcatcatgatcggcacgtacgcgctctcctcgggctactacgacgcc
tactacggccaggcgcagaaggtccgcaccctcatcacgcgggacttcaccagcgcgttc
gagcaggtagacgcgctgatctcgccgaccacgccgttcgtggcgttcccgctggggtcg
cgcaccgccgacccgtaccagatgtacctggcggacctgttcaccatcccgacgaacctg
tacggcggcccggcgatctcggtgccgtgcggactgtccgacgggctcccggtcggcttc
cagatcatggcgccgaccatggcggacgaccggatgtaccgggtcgccgccgcgctggag
agcgccgtcggcacgcttaccccgccgacgctctga

DBGET integrated database retrieval system