KEGG   Micromonospora sp. B006: MicB006_1674Help
Entry
MicB006_1674      CDS       T05583                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
micb  Micromonospora sp. B006
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AXO33969
UniProt: A0A385APS9
LinkDB All DBs
Position
complement(1725684..1726796)
Genome map
AA seq 370 aa AA seqDB search
MDLPINPPVEPMLAKSVAELPTDPGLTYEPKWDGFRCIVFRDGDEVELASRGGKSMTRYF
PEVVEQARRQLPPRCAVDGELIVIRRDGPGGQPRLDFELLAQRIHPAASRVKLLAETTPA
DFVAFDLLAIDDELLTEQPYPRRRERLEQALSGVRPPVHVTQVTTDPETARRWFEVFEGA
GLDGLIVKPADLPYEPGKRLMFKVKHARTMDAVVAGFRWHKSGPVVGSLLLGLYDDQGVL
HHIGVSSSFTMARRKELLDELEPYREVGGEHPWVHGDHERGQRIPGGVSRWTGGKNLEWE
PLRPELVVEVAYDAMEGDRLRHTARFLRWRPDRDPRSCDYSQLDRPIRYDVDEVLRGDPA
ATVGDTRGRA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgccgatcaaccctccggtcgagccgatgctggccaagagcgtggccgagctg
cccaccgatcccggtctgacctacgagccgaagtgggacggcttccgctgcatcgtgttc
cgcgacggtgacgaggtcgagctggccagccggggcggcaagtcgatgacgcgctacttc
cccgaggtggtggagcaggcacgccggcagctcccgccccggtgcgcggtcgacggcgag
ctgatcgtgatccgccgggacgggccgggcgggcagccgcggctcgacttcgagctgctg
gcccaacggatccatccggccgcctcccgggtgaagctgctggccgagaccactccggcc
gacttcgtcgcgttcgatctgctggcgatcgacgacgagctgctcaccgagcagccctac
ccccgccgccgcgagcggttggagcaggcgctgtccggggtgcgcccgccggtgcacgtg
acccaggtgaccaccgacccggagacggcccgccgctggttcgaggtgttcgagggcgcc
ggcctggacgggctgatcgtcaagccggccgacctgccgtacgagccgggcaagcggctc
atgttcaaggtcaagcacgcgcgcacgatggacgcggtggtggccggcttccgctggcac
aagtccggcccggtggtgggctcgctgctgctgggcctctacgacgaccagggcgtgctg
caccacatcggcgtcagctcctcgttcaccatggcccgccgcaaggagctgctggacgag
ctggagccctaccgcgaggtgggcggcgagcacccgtgggtgcacggcgaccacgagcgg
ggccagcgcatcccgggcggggtgagccggtggaccggcggcaagaatctggagtgggag
ccgctgcgcccggagctggtggtcgaggtggcgtacgacgcgatggagggcgaccggctg
cggcacaccgcccggttcctgcgctggcggcccgaccgtgatccccgctcgtgcgactac
agccagctcgaccgcccgatccgctacgacgtcgacgaggtgctgcgcggcgatccggcg
gcgacggtcggtgacacccgcggccgggcgtag

DBGET integrated database retrieval system