KEGG   Micromonospora sp. B006: MicB006_2904
Entry
MicB006_2904      CDS       T05583                                 

Definition
(GenBank) 2-amino-37-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
micb  Micromonospora sp. B006
Pathway
micb00997  Biosynthesis of various secondary metabolites - part 3
micb01100  Metabolic pathways
micb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    MicB006_2904
Enzymes [BR:micb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     MicB006_2904
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AXO35185
UniProt: A0A385AT10
LinkDB
Position
complement(3051454..3052278)
AA seq 274 aa
MAVLNASFARGLRLRRLFRRGDGRLLVVPLDHSVTDGPLRRGDLNSLLGELAGTGVDAVV
LHKGSLRHVDHGWFGDMSLIVHLSVSTRHAPDPDAKYLVAHVEEALRLGADAVSVHVNLG
SPQEARQIADLAAVAGECDRWNVPLLAMVYARGPQITDSRAPELVAHAATLAADLGADIV
KTDYVGTPEQMAEVVRGCPIPLIVAGGPRSADTPTVLAYVSDALRGGVAGMAMGRNVFQA
EQPGLMAAAVARLVHEPRHVPDRYDVDDRLALTS
NT seq 825 nt   +upstreamnt  +downstreamnt
gtggccgtactcaacgcttcgttcgctcgtggcctgcgtctgcgccgactgttccggcgc
ggcgacggacgcctgctcgtcgtcccgctcgaccactccgtcaccgacgggccgctgcgc
cgcggcgacctgaactcgctgctcggtgagctcgccggcaccggcgtggacgccgtggtg
ctgcacaagggcagcctgcggcacgtcgaccacggctggttcggcgacatgtcgctgatc
gtgcatctgagcgtgagcacccggcacgccccggacccggacgcgaagtacctggtcgcg
cacgtggaggaggccctgcggctgggggccgacgcggtcagcgtgcacgtcaacctcggc
tcaccgcaggaggcgcggcagatcgccgacctggcggcggtggcgggggagtgcgaccgc
tggaacgtcccgctgctggccatggtgtacgcccgcgggccgcagatcaccgactcccgg
gctccggagctggtggcgcacgccgcgacgctcgccgccgacctcggcgccgacatcgtc
aagaccgactacgtgggcacgcccgagcagatggccgaggtggtgcgcggctgcccgatc
ccgctgatcgtggccggcggcccgcgctcggccgacactccgacggtgctcgcctacgtc
tcggacgcgctgcgcggcggcgtggccgggatggccatgggccgcaacgtgttccaggcc
gagcagcccggcctgatggccgccgccgtggcacggctggtgcacgagccacggcacgtg
ccggaccggtacgacgtcgacgaccggctcgcccttacgtcctga

DBGET integrated database retrieval system