KEGG   Micromonospora sp. B006: MicB006_3047Help
Entry
MicB006_3047      CDS       T05583                                 

Definition
(GenBank) malonyl CoA-acyl carrier protein transacylase
Organism
micb  Micromonospora sp. B006
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc adh_short PP-binding Docking Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd SAT
Motif
Other DBs
NCBI-ProteinID: AXO35328
UniProt: A0A385ATN9
LinkDB All DBs
Position
complement(3245131..3256080)
Genome map
AA seq 3649 aa AA seqDB search
MADEAKLLDYLKRVTADLHQVRQRLREVEAGEQEPVAIVSMSCRFPGGVRSPEDLWEVVA
SGRDVVTDFPEDRGWDLGSLYDSDPEQSGTSYTRQGGFVHDLADFDPGFFAISPREALAM
DPQQRWLLETSWEALERAGIDPHSLRGSRTGVFAGSTGQDYGTVLMGAAQGLEGHLMTGN
AGSVVSGRIAYTFGLEGPAVTIDTACSSSLVALHLAGQALRQRECTLAIVAGVTAMCTPA
AFVEFSRQRGLAADGRCKSFAAAADGTGWSEGVGVLVLERLSDAQRNGHPVLAVVRGSAV
NQDGASNGLSAPNGPSQQRVIQQALANAGLATGGVDVVEAHGTGTRLGDPIEAQALLATY
GQDRGDSAPLLLGSVKSNIGHAQAAAGVAGVIKMVMAMRHGVVPPTLHVDEPTPEVDWSA
GEVSLVTEATPWPAVSRPRRSAVSSFGVSGTNAHTILEQAPAPQQSPSAAAALLVERPVV
PVPVSARDAAGLAAQAGRWAARIAADETLRPLDVAFSSVTSRSTLEHRAVVSATGREELL
GGLRALAAGQPSGAVVVGQAGGRGSLAVLFSGQGAQRAGMGRELYAEFPVFAAAFDEVCG
HLDALLPRPLREVLFAAEGSADAELLDRTVFTQAGLFAVEVALFRLVESFGVAPDLVGGH
SIGEVTAAYVAGVLSLEHACALVAARGRLMHALPAGGGMLAVAAAEADVAAALDGLAGVG
IAAVNGPQAVVVSGAVESLDEVERLWKDRGVRVRRLTVSHAFHSPLMEPMLADFRAVLDG
LEFAAPVLPVVSNVTGALAGDEIRTPDYWVRHVRQAVRFADGVAALRAAGADTFLEIGPR
SVLTAMVGDVLPGGDGVLAVAAQRVDRPEVHGLLGGLAELHVHGVAVDWRPWFAETGARR
VDLPTYAFQHQRYWPEAGAGWTGDVTAVGLRPAQHPLLGAAVGVAHAEGFLFTGRLARRT
HPWICDHVVFDTVLLPGTGFVELALQAGAHVGADHVRELTLESPLILPETGGVDIQLWIG
PADETGCRSVSLHSAQDGEPTEGAGERTWTRNASGVLASGPAAPSGPAGWSDLTTWPPPG
ATEVGTDDLYLSLAAQGYDYGPSFIALRSAWRRGDDLFAELALPEAPAAEAGGYGLHPAL
LDAALHTLGLTTPAGEPSGAGMPPGYGRLPFSWNDVALHGAGAAAARVRVSHTGPDSISL
LLTDVTGAPVISVGSLVLRPVSADQLRTASGGGTESLFRVEWAPLALPAGPSTVDWAVIG
DAAALTDAVAATGTAVAAYPDLTALATAMDDGTDAPGMLVLPLLDPPASADVPRAVAEAT
HRVLAVLQQFLAEERYAVSRLVVLTSGAVATDRDADLTDLAGAAVIGLLRSAQSENPDRF
VLVDVDDVAGCAAALVPAVATDEPQVVIRAGVAAGARLTRVPAPAEPPAAPFDFDGTVLI
TGATGTLGQLMSRHLVSAYGVRHLILTSRRGRAAGGVAELCAELEALGVSVTVAACDVAD
RAAVAELLAGIPAEHPLTAVVHAAGVRDDGVISSLTPERMDGVLRPKVDAAWHLHELTAD
LGLKAFVSYSSLAATAGGPGQGNYAAANAFLDGLAQHRKARGLAALTLAWGLWADRSGMT
TELDDVHLNRISRSGVAAMEAEEGLALFDAACRTTDAALVPARLDLAAMKVQFAGGSIPP
LYRALIRTPARTAAATTGASLVQQLAGLGDAERAAALVEIVRGQAAAVLGYPDPAAIEPR
RAFSEFGFDSLTAVEMRNRLNNAFGMRLPATLVFDYPTPHDLAGFLGTEIAGTPVPVRPA
TTTVPVGDDEPLAIIGMACRLPGGVWSPDDLWRLVVDGVDAISDLPTDRGWDLDSLYSPD
PDAPGTFYARGGGFLSGVDRFDPGFFGISPREALAMDPQQRLLLETTWESFESAGIDPAD
VRGSSTGVFVGTSGQDYGSLLAYSPEAAEGYMLTGMTSSVISGRVAYTFGLEGPAVSLDT
ACSSSLVALHWAGQALRRGECDMALAGGVMVMATPTAFVEFSRQRGLAADGRCKSFAASA
DGTGWSEGVGMLLVQRLSDARRQGRTVYAVVRGSAINQDGASNGLTAPNGPSQQRVIRQA
LASARLSAADVDVVEAHGTGTTLGDPIEAQALLATYGRERPADRPLLLGSVKSNIGHAQA
AAGVAGVIKMVQAIRHGLVPATLHVDEPSPHIDWTSGAVELATESRPWPAVDRPRRAAVS
SFGISGTNAHVIIEQGDEPVDAARVDTRPGLVDSGVVAWPLSGRSREALTGQAARLARHV
REHGEVDAAAVGWSLATTRSTFDHRAAVVGSSTEELLAGLDALASGSPAGNVVTATSSSH
GAGPVFVFPGQGAQSARMAAGLVGRVPVFDARLAECQRALASYLDVDLVSVLTGDDESWL
ERVEVVQPVLWAVGVALAAVWQHAGVVPAAVVGHSQGEIGAACVAGILSLEDAAKAVALR
SRALTALRGTGTMASVDLRADAVTERLPGFPGVGVAAVNGPSTVVVSGPPQPVADLVESC
QADGVRARLIPVDYASHSEAVQEVAERLRADLADVTPRPGHVRMVSTLTGDWVDPASMDA
SYWYDNLRQTVRFDAAVRVAVEAGHTTFVEISPHPVLTMPVTAILDDVGASGHTLGSLRR
GDDDPTRLLTNLATAHTIGLPVDLTAVLAETDVVALPTYAFDHQRYWVEPPAHRAQDVSS
AGLQDAGHPLLSATLTFPDSERMVFTGRLSVRTHPWLGEHRVMDNILLPGTAFVELATYA
GAQAGCPTVEELTLLAPLVLPELGALQVQLTVGDRDDDGRRTVQLYSRPYRDGSDEILAD
VAWTCHATGLLGPQPADAAPAFDLGVWPPPGATRVESDDFYSGIEATVFGYGPAFRGLRA
AWIRDDEVFAEVELPAGHHAEAGRFGVHPALLDGALQAMSIGGFLGRMGDGADAGVPRLP
FAWTGVSLLAAGATALRVRVAAAGEVGVSFQVADATGAPVLHVDSLIMRRVSGDSLGAAR
SGRHESLFQVDWPVLPVPTGPVPAAIRWVALGDDLVLSAACEAAGARVRTDVGLDTLGDL
LAGGEPAPELVIVPVGDAGNPSDPELAVQARAATHRTLAALRTWLADDRFADSRLVLVTR
DAVAAGEQEPVNLRQAPVWGLLRAAQLEHPGRCQIVDLDDAPDSAAALAAAIASGEPQLA
VRDGQVRTPRLGRVPAGVEPLPGGIDPAGTVLITGGTGVLGRILARHLATSHGVRHLLLA
GRRGAAAEGIGDLVGELAGTGTEVTVAACDAADPEALSALLAGVPAAHPLTAVVHAAGVL
DDGVLESMTPERVDAVAVPKIDAAWHLHRLTADANLAAFVLFSSAAATLGSAGQSNYAAS
NAFLDALAAHRRARGLAGISLAWGLWAQASGMTGHLGDDDVRRMAEQGATGLSTEQALNL
FDAAWRLDAAAVLPMRLDVGTLRGQAETGTLAPMLRALVRVPLRRSMDATGARSGGVQLG
RRLAGLAAPERLKVVLDVVRANIAAVLGHAGSDAVDPNRLFTDLGFDSLTAVDLRNRLNS
LSGLRLPATLVFDYPTPTALAEKLTSEIAADAAPSTQPLFQGIDTVESLLTTIPLDPAAR
ARFTARMQDLLAKASDLAAGPAVEPDRPDLDSASDDEIFDFISKEFGIS
NT seq 10950 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaggcgaagcttctcgactacctcaagcgggtcaccgctgacctgcaccag
gtgcgccagcgcctgcgcgaggtggaggccggtgaacaggaaccggtcgccatcgtctcc
atgagctgccgcttccccggcggggtgcgctctcccgaggacctgtgggaggtggtcgcg
tccggccgggacgtggtcaccgacttccccgaggaccgcggctgggacctcgggtcgctc
tacgacagcgaccccgaacagagcggcacgtcgtacacgcggcagggcggcttcgtccac
gacctggccgacttcgacccgggcttcttcgcgatctccccccgcgaggcgctggcgatg
gacccgcagcagcgctggctgctggagacatcgtgggaggccctggagcgggccggcatc
gacccgcactcgctgcgcggcagccgcaccggcgtcttcgccggcagcaccggccaggac
tacggcaccgtgctgatgggtgccgcgcagggcctggaggggcacctgatgaccggcaac
gccggcagcgtggtctccggccggatcgcctacaccttcgggctggagggcccggcggtc
accatcgacaccgcctgctcgtcctcgctggtcgccctgcacctggcggggcaggcgctg
cggcagcgggagtgcaccctggcgatcgtcgccggggtcaccgccatgtgcaccccggcc
gccttcgtcgagttctcccggcagcgcggcctcgccgccgacggccgctgcaagtcgttc
gccgccgccgccgacgggaccggctggtccgagggcgtcggcgtcctggtgctggagcgg
ctgtcggacgcgcagcgcaacggccaccccgtcctcgccgtggtgcggggcagcgccgtc
aaccaggacggcgcctccaacggcctgagcgccccgaacgggccgtcgcagcagcgggtg
atccagcaggcgctggccaacgccggcctcgccaccggcggcgtggacgtggtggaggcg
cacggcaccggcacccggctcggcgacccgatcgaggcgcaggcgctgctcgccacgtac
gggcaggaccggggggactcggcgccgctgctactcgggtcggtcaagtcgaacatcggt
cacgcccaggcagccgccggcgtggccggtgtgatcaagatggtgatggcgatgcggcac
ggcgtcgtaccgcccaccctgcacgtggacgagccgacgcccgaggtcgactggtcggcc
ggcgaggtgtcgctggtgaccgaggcgacgccgtggcctgcggtgagccggccgcgccgc
tcggccgtctcctcgttcggggtgtccggcaccaacgcccacaccatcctggagcaggct
ccggcgccccagcagtccccgtcggccgccgccgcgttgctggtcgagcggccggtcgtg
ccggtgccggtgtcggcccgggacgcggccggcctcgccgcgcaggcgggccgctgggcg
gcccggatcgccgccgacgagaccctgcggcccctggacgtggccttctcgtcggtcacc
tcacgctccaccctggagcaccgggccgtggtctccgcgaccggccgtgaggagttgctg
ggcgggttgcgtgccctggccgccgggcagccgtcgggtgcggttgtcgtgggccaggcc
ggcggccggggttcgttggcggtgctgttctcgggtcagggcgcgcagcgcgccgggatg
ggccgggagttgtacgccgagttcccggtgttcgctgcggcgttcgacgaggtgtgcggg
cacctggatgcgctgctgccgcgcccgctgagggaggtgctcttcgccgctgagggctcg
gccgacgccgagctgctggaccggaccgtgttcacgcaggcggggttgttcgcggtcgag
gtggcgttgttccgtctcgtcgagtccttcggggtcgcccccgacctggtcggcgggcac
tcgatcggtgaggtcacggccgcgtacgtggccggggtgctgtcgctggagcacgcctgc
gcgctggtggcggcgcggggccggttgatgcatgcgctgcccgctgggggcgggatgctg
gccgtcgcggcggccgaggccgacgtggcggctgcgctggacgggttggccggtgtgggg
atcgcggcggtcaacggtccgcaggctgttgtggtctccggtgccgttgagtccctcgac
gaggtggagcggctctggaaggaccggggtgtacgcgtccgccgcctaaccgtcagtcac
gcgttccacagtccgttgatggagccgatgctcgccgatttccgggccgttctcgacggg
ttggagttcgccgcgccggtgctgccggtcgtgtcgaacgtgaccggtgccctggccggc
gatgagatccgtacgcccgactattgggtgcggcatgtccggcaggcggtgcgtttcgct
gacggggtcgccgcgctgcgcgccgctggggcggacacgttcctggagatcggcccccgc
agcgtgctgaccgcgatggtcggcgatgtgctgccgggcggggacggggtgctggccgtc
gccgcgcagcgcgtggaccggcccgaggtgcacgggctgctgggcgggctggccgagttg
cacgtgcacggggtggcggtcgactggcggccgtggttcgccgagaccggcgcgcggcgg
gtggacctgcccacgtacgccttccagcaccagcgctactggcccgaggcgggcgccggg
tggaccggcgacgtcaccgccgtcggcctgcgccccgcgcaacaccccctgctcggggcc
gccgtcggcgtcgcgcacgccgagggattcctgttcaccggccggctggcccggcgtacc
cacccgtggatctgtgaccacgtcgtcttcgacaccgtgctgctgcccggcacgggcttc
gtcgaactcgccctccaggccggcgcgcacgtcggcgcggaccacgtccgcgaactcacc
ctggagtcgccgctgatcctgccggagaccgggggcgtcgacatccagctctggatcggc
ccggccgacgagaccggctgccggtccgtgtcgctgcactccgcccaggacggcgagccg
accgagggcgcgggcgagcggacctggacccgcaacgccagcggcgtgctggccagcggc
cccgccgccccgagcggccccgccggctggtccgacctgaccacctggccgccgccgggc
gccaccgaggtcggcaccgacgacctctacctgagcctcgccgcccagggctacgactac
ggcccgtccttcatcgccctgcgctccgcgtggcggcgcggcgacgacctcttcgccgag
ctggcgctgcccgaggcccccgctgccgaggccggcgggtacggcctgcacccggccctg
ctcgacgcggcgctgcacaccctcggcctgaccacgccggccggagagccttcaggggcg
ggcatgcccccggggtacggccggctgccgttctcctggaacgacgtcgccctgcacggc
gccggggccgcggcggcccgcgtccgggtctcgcacaccggccccgacagcatctcgctg
ctgctcaccgacgtcaccggcgcgcccgtcatctccgtcggctccctggtcctgcggccg
gtctccgccgaccagctccgcaccgcctccggcggcggcaccgagtcgctcttccgggtc
gagtgggcgccgctcgcgctgcccgccggcccgtcgacagtcgactgggcggtcatcggc
gacgccgcggcgctcaccgacgcggtcgcggccaccggcacggccgtggcggcgtacccc
gacctgacggccctggccacggcgatggacgacgggacggacgcgcccggcatgctggtc
ctgccgttgctcgacccgcccgcgtcggcggacgtgccgcgcgccgtcgccgaggcgacc
caccgggtgcttgccgtgctccagcagttcctcgccgaggagcgctacgcggtgtcccgg
ctggtggtgctgacctcgggcgcggtcgccaccgaccgggacgccgacctgaccgacctg
gccggcgccgccgtgatcggcctgctccgctccgcccagtcggagaaccccgaccggttc
gtgcttgtcgacgtcgacgacgtggccggctgtgccgccgcgctcgtcccggccgtcgcg
accgacgaaccgcaggtcgtgatccgcgcgggtgtcgccgccggcgcccggctcacccgg
gttcccgccccggccgagccgccggccgccccgttcgacttcgacggcaccgtcctgatc
accggcgccaccggcaccctcggccagctgatgagccggcacctggttagcgcgtacggc
gtccggcacctcatcctcaccagccggcgcggccgcgccgccgggggcgtcgcggagctc
tgcgccgagctggaggcgctcggcgtgagcgtcaccgtcgccgcctgcgacgtcgccgac
cgcgccgccgtggccgagctgctggccggcatcccggcggagcaccccctcaccgccgtc
gtccacgccgccggcgtccgcgacgacggcgtcatctcctcgctcacccccgagcggatg
gacggcgtgctgcggcccaaggtcgacgccgcgtggcacctgcacgagctgaccgccgac
ctcggcctgaaggcgttcgtctcgtactcctcgctggccgccaccgcaggcggcccgggc
cagggcaactacgccgccgcaaacgcgttcctcgacgggctggcccagcaccgcaaggcg
cgcggcctcgccgcgctcaccctcgcctggggcctctgggccgaccgcagcggcatgacc
accgagctggacgacgtccacctcaaccggatctcccgctccggcgtcgccgccatggag
gccgaggaggggctcgcgctcttcgacgcggcctgccgcaccaccgacgccgcgctcgtc
ccggcccggctggacctcgccgcgatgaaggtgcagttcgccggcgggagcatcccgccg
ctgtaccgggcgctgatccgcacgcccgcgcgcaccgccgcggccaccaccggcgcgtca
ctggtgcagcagctcgccgggctgggcgacgccgagcgggccgccgcgctggtcgagatc
gtccgcgggcaggccgccgccgtgctcggctaccccgacccggcggccatcgagccgcgc
cgggcgttcagcgagttcggcttcgactcgctgaccgccgtcgagatgcgcaaccggctc
aacaacgccttcgggatgcggctgccggccaccctcgtcttcgactacccgaccccgcac
gacctggcgggcttcctgggtacggagatcgccggcaccccggtccccgtgcgacccgcg
acgaccaccgtgccggtcggcgacgacgagcccctcgcgatcatcggcatggcctgccgg
ctgcccggcggcgtgtggtcgcccgacgacctgtggcggctggtggtcgacggcgtcgac
gcgatcagcgacctgccgaccgaccgtggctgggacctcgacagcctctacagccccgac
cccgacgcccccggcaccttctacgcccgcggcggcggcttcctcagcggcgtcgaccgg
ttcgaccccggcttcttcggcatctcgccccgcgaggccctggccatggacccgcagcag
cggctgctgctggaaaccacctgggagtccttcgagtccgccggcatcgacccggccgac
gtacggggcagcagcaccggcgtcttcgtcggcaccagcggccaggactacggctcgctg
ctcgcgtactcgccggaggccgccgagggctacatgctgaccgggatgaccagcagcgtc
atctccggccgggtggcgtacacgttcgggctggaggggccggcggtgtcgctggacacg
gcctgctcctcgtcgctggtggccctgcactgggccggtcaggcgctgcggcgcggcgag
tgcgacatggccctcgccggtggcgtgatggtgatggccaccccgaccgccttcgtcgag
ttctcccggcagcgcggcctggccgccgacggccggtgcaagtcgttcgccgcgtccgcc
gacggcaccggctggtccgagggcgtgggcatgctgctcgtgcagcggctctccgacgcg
cgccggcagggccgcaccgtgtacgcggtggtgcgcggctcggcgatcaaccaggacggc
gcctcgaacgggctgaccgccccgaacggcccgtcgcagcagcgggtgatccggcaggcg
ctggcgtcggcgcggctctccgcggccgacgtggacgtggtcgaggcgcacggcacgggc
acgacgctcggtgacccgatcgaggcgcaggccctgctggccacgtacgggcgggagcgg
cccgccgaccggccgctgctgctcggctcggtcaagtcgaacatcggccacgcccaggcc
gccgccggggtggccggtgtgatcaagatggtgcaggccatccggcacggcctcgtcccg
gcgacgctgcacgtggacgagccgtccccgcacatcgactggacctccggcgccgtcgag
ctggccacggagtcgcggccgtggccggcggtggaccggccgcgtcgggcggcggtgtcg
tcgttcggcatctccggcacgaacgcccacgtgatcatcgagcagggtgacgagccggtc
gacgccgcacgcgtggacacacggcccggcctcgtggattccggcgtcgtggcatggccg
ctgtcggggcggtcgagggaagccctgaccggccaggcggcccggctggcccggcacgtg
cgcgagcacggcgaggtcgatgcggcggcggtgggctggtccctggcgacgacccggtcg
acgttcgaccaccgggcggcagtggtcgggtcgagcacggaggagttgctggcggggctg
gacgctctggcgtcggggtcgccggccggcaacgtggtcacggcgacgtcgtcgtcgcac
ggtgcgggcccggtgttcgtgtttccgggtcagggtgcgcagtcggcgcggatggcggcg
ggcctggtgggtcgtgtgccggtgttcgacgcgcgcctggcggagtgccagcgggcgttg
gcgtcgtatctggacgtggacctcgtgtcggtgttgaccggtgacgacgagtcgtggctg
gagcgggtggaggtcgtgcagccggtgctgtgggccgtcggggtcgccctcgccgccgtg
tggcagcacgcgggtgtggttccggcggcggtggtcggtcactcgcagggtgagatcggc
gcggcgtgcgtggcggggattctctccctggaggacgcggcgaaggcggtggcgttgcgt
tcccgggccctgaccgcgctgcggggcaccgggacgatggcgtcggtcgacctccgcgcg
gacgcggtgacggagcggctgccgggcttccccggggtgggcgtcgcggcggtgaacggt
ccgtcgacggtggtggtgtcgggtccgccgcagccggtcgccgacctggtggagtcgtgt
caggccgacggggtgcgggcgcggttgatcccggtggactatgcgtcgcactcggaggcg
gtgcaggaggtggcggagcggttgcgcgccgatctggccgacgtgactccgcggcccggc
catgtccggatggtgtcgacgttgaccggtgactgggtcgatccggcgtcgatggacgcc
agttactggtacgacaacttgcggcagactgtgcggttcgacgccgctgtgcgggtggcg
gtcgaggcgggtcacacgacgttcgtggagatctccccgcatccggtgttgacgatgccg
gtgacggcgatcctggatgacgtcggcgcgagcgggcatacgttgggcagcttgcgtcgt
ggtgacgacgatccgacgcggttgctgacgaacctcgcgaccgcccacacgatcggcctg
cccgtcgacctgacggccgtcctcgccgagaccgacgtggtggcactgcccacctacgcc
ttcgaccaccagcggtactgggtcgagccgccggcgcaccgggcgcaggacgtcagctcc
gccggtctccaggacgccgggcacccgctgctcagcgccacgctgacgttccccgacagc
gagcggatggtcttcaccggccggctgtcggtgcgtacccacccgtggctcggcgagcac
cgggtgatggacaacatcctgctgcccggcaccgccttcgtggaactcgccacgtacgcc
ggtgcgcaggccggctgcccgacggtggaggagttgacgctgctcgccccgctcgtcctg
cccgaacttggcgcgctccaggtgcagctgacggtcggcgaccgcgacgacgacgggcgg
cgcaccgtccagctctactcccggccctaccgggacggctccgacgagatcctcgccgac
gtcgcctggacctgccacgccaccggcctgctcggcccgcagccggccgacgccgcgccc
gccttcgacctgggggtgtggccgccgcccggcgcgacgcgcgtcgagtccgacgacttc
tactccggcatcgaggcgaccgtcttcgggtacgggccggcgttccggggtctgcgtgcc
gcgtggatccgcgacgacgaggtcttcgcagaggtcgagctgcccgccggccaccacgcc
gaggccggccgcttcggcgtgcacccggcgctgctggacggcgcgctgcaggccatgtcg
atcggcggcttcctcggccggatgggcgacggcgccgacgccggcgtgccccgtctgccg
ttcgcctggaccggggtctccctgctcgccgccggggccaccgccctgcgcgtgcgcgtc
gccgcggccggcgaggtcggcgtctccttccaggtggccgacgccaccggcgccccggtg
ctgcacgtcgactcgctgatcatgcgccgtgtctccggggactccctcggcgcggcgcgc
tccggccggcacgagtcgctgttccaggtggactggcccgtgctgccggtgcccaccggc
cccgtgccggcggccatccgctgggtggcgctcggcgacgacctggtgctcagcgcggcc
tgcgaggcggccggtgcccgggtgcgtaccgacgtcgggctcgacaccctcggcgacctg
ctcgccgggggtgagccggcgcccgagctggtgatcgtcccggtcggcgacgccgggaac
ccgtcggacccggagctcgccgtgcaggcgcgcgccgccacgcaccgtacgctcgccgcg
ttgcggacctggctcgccgacgaccggttcgccgactcgcggctggtgctcgtcacccgg
gacgcggtcgcggcgggggagcaggagccggtgaacctgcgccaggccccggtctggggc
ctgctgcgcgccgcccagctcgaacacccgggccggtgccagatcgtcgacctcgacgac
gccccggacagcgccgccgcgctggcggccgccatcgcctccggcgagccgcagctcgcc
gtgcgcgacgggcaggtccgcaccccacggctcggccgggttccggccggtgtcgagccg
ctgcccggcgggatcgacccggccggcaccgtgctgatcaccggcggcacgggcgtgctg
ggccgcattctggcccgccacctcgccaccagccacggcgtacggcacctgctgctggcc
gggcggcgcggcgcggcggccgaggggatcggcgacctggtcggcgaactcgccggcacc
ggtacggaggtgaccgtcgcggcctgcgacgccgccgaccccgaggccctgtcggcgctg
ctggccggggtgccggcagcgcacccgctcaccgccgtggtgcacgccgccggcgtcctc
gacgacggcgtgctggagtcgatgacccccgaacgggtggacgcggtcgccgtgccgaag
atcgacgccgcctggcacctgcaccgcctcacggccgacgcgaacctcgcggccttcgtc
ctgttctcgtcggcggcggccacgctgggcagcgccggccagtccaactacgcggcgtcg
aacgccttcctcgacgccctcgcggcgcaccgccgggcacgcgggctcgccggcatctcg
ctcgcctggggcctgtgggcgcaggccagcggcatgacgggccacctcggcgacgacgac
gtgcggcggatggccgagcagggcgccaccggcctgtccaccgagcaggcgctgaatctc
ttcgacgccgcgtggcggctcgacgcggcagccgtcctgccgatgcgcctggacgtcggg
acgctgcgcgggcaggcggagaccggcaccctcgcgcccatgctccgggccctggtccgg
gtgccgctgcgacgctccatggacgccaccggtgcccgctccggcggggtgcagctcggc
cggcggctcgccggactggccgccccggagcggctcaaggtggtgctcgacgtggtacgc
gcgaacatcgccgccgtcctcggccacgccggctcggacgcggtcgacccgaaccggctc
ttcaccgacctgggcttcgactcgctcaccgccgtcgacctgcgcaaccggctcaacagc
ctgtccggcctgcggctgccggcgacgctcgttttcgactacccgacgccgacggcgctc
gccgagaagctgacgagcgagatcgccgccgacgcggcgccctccacccagccgctcttc
cagggcatcgacacggtggagagcctgctcaccaccatcccgctcgacccggctgcccgc
gcgcggttcaccgcccggatgcaggacctgctcgccaaggcgtccgacctggcggccggg
cccgccgtcgaaccggaccggccagacctcgactcggccagcgacgacgagatcttcgac
ttcatcagcaaagagtttggaatctcctga

DBGET integrated database retrieval system