KEGG   Micromonospora sp. B006: MicB006_3207Help
Entry
MicB006_3207      CDS       T05583                                 

Definition
(GenBank) alanine--glyoxylate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
micb  Micromonospora sp. B006
Pathway
micb00250  Alanine, aspartate and glutamate metabolism
micb00410  beta-Alanine metabolism
micb00640  Propanoate metabolism
micb00650  Butanoate metabolism
micb01100  Metabolic pathways
micb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MicB006_3207
   00650 Butanoate metabolism
    MicB006_3207
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MicB006_3207
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MicB006_3207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:micb01007]
    MicB006_3207
Enzymes [BR:micb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MicB006_3207
Amino acid related enzymes [BR:micb01007]
 Aminotransferase (transaminase)
  Class III
   MicB006_3207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AXO35487
UniProt: A0A385AUE3
LinkDB All DBs
Position
complement(3599736..3601031)
Genome map
AA seq 431 aa AA seqDB search
MTSDDLLARHRAVLPSWMPLYYAEPLELVAGSGRRVTDAAGRTYLDFFGGVLTTMVGHDI
PEIREAVERQLRTGLVHTSTLYLIRQQVELAEKIARLSGIPDARVFFTNSGTEANEAALL
VATNHRRSHQILAVRNSYHGRSYATMGVTGNRGWSASALNPLQVAWLHSGERLRGLLARL
DAADRVDAAVEDLREVLATQTAGDVACLIAEPVQGVGGFVHGPDGLFAAWKKVLDEHGIL
LISDEVQTGWGRTGEHFWGYQAHGVTPDLLTFAKGIGNGFALAGVVGRAEVLESVPAISF
STFGGNPVSTAAGNAVLDYLLDHDLQANAARVGAILGDGLRAATAGLGQVAEVRGKGLML
AVEFVHPGTVEPDAALTTRVFEACRAGGLLVGKGGLYGNVIRMGPPLTLTEDEAREGLAI
LVEAVHSAIGG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgacgacctgctggcccggcaccgggcagtgctcccgtcctggatgccgctc
tactacgccgaaccgctggaactggtggccggctccggccgccgggtcaccgacgcggcc
ggccggacctatctggactttttcggcggggtgctgaccacgatggtcggtcacgacatc
ccggagatccgggaggcggtcgagcggcaactgcgtaccggcctcgtgcacacctccacg
ctctacctgatccgccagcaggtcgagctggccgagaagatcgcccggctctccggcatt
ccggacgcccgcgtcttcttcaccaactccggcaccgaggcgaacgaggccgcgctgctg
gtcgccacgaaccaccggcgctcgcaccagattctcgcggtgcgcaacagctaccacggc
cggtcgtacgcgacgatgggtgtcaccggcaaccgcggctggtcggccagcgcgctgaac
ccgttgcaggtggcctggctgcactccggcgagcggctgcgcgggctgctggcccggctg
gacgccgccgaccgggtcgacgcggcggtcgaggacctgcgcgaggtgctcgccacccag
accgccggcgacgtggcctgcctgatcgccgagccggtccagggcgtcggcggcttcgtg
cacggcccggacggcctcttcgccgcctggaagaaggtgctcgacgagcacggcatcctg
ctgatcagcgacgaggtgcagaccgggtggggtcgcaccggcgagcacttctggggctac
caggcgcacggcgtgacgccggacctgctcaccttcgccaagggcatcggcaacggcttc
gcgctggccggggtggtcggccgggccgaggtgctggagtcggtgccggcgatcagcttc
tccacgttcggcggcaacccggtctccaccgccgccggcaacgcggtgctcgactacctg
ctcgaccacgacctccaggccaacgccgcccgggtcggcgcgatcctcggcgacggcctg
cgcgctgcgaccgccgggctgggccaggtcgccgaggtgcgcggcaagggcctgatgctc
gccgtcgagttcgtccacccgggaaccgtcgagccggacgcggcgctgaccacccgcgtc
ttcgaggcgtgccgggccggcggcctcctggtgggcaagggcggcctgtacggcaacgtg
atccggatgggcccgccgctgacgctcaccgaggacgaggcccgcgagggtctggcgatc
ctggtcgaggccgttcacagcgcgatcggcgggtga

DBGET integrated database retrieval system