KEGG   Micromonospora sp. B006: MicB006_4200Help
Entry
MicB006_4200      CDS       T05583                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
micb  Micromonospora sp. B006
Pathway
micb00500  Starch and sucrose metabolism
micb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MicB006_4200
Enzymes [BR:micb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MicB006_4200
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MicB006_4200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase GHL5
Motif
Other DBs
NCBI-ProteinID: AXO36469
UniProt: A0A385AWW0
LinkDB All DBs
Position
complement(4656430..4658082)
Genome map
AA seq 550 aa AA seqDB search
MGDRWYQEAVVYCLDVDTFADSDGDGVGDFQGLIGRLDYLARLGVTCLWLNPIHPSPNED
DGYDATDFYNVDPRLGTLGDFAELLHQASNRGIRVIIDLVVNHTSDQHPWFQSARSSPDS
PYRDWYVWADHEPADRHQGMVFPGEQHETWTYDRTAKAWFYHRFYKFQPDLNIENPKVRA
EIKKITSFWLQLGVAGFRMDAVPFIIERTEPGNPNSPKDFDFITDLRQHVQWRRGDAVLL
AEANVEPDELPVYFGDGSGSGNRIHMLFDFMLNGRLMLALAREDPEVIIEALRDTPKLPT
GGQWATFLRNHDEIDLSRLTADQRNDVLAKFGPDENMQLYGRGIRRRLAPMLGNDRRHIE
LAYSLQFSLRGTPVLRYGEEIGMGEDLSLDGRDAIRTPMQWSYADNAGFSTAEPEKLVRP
VIDKGEYGYQKVNVTAQRKDPRSLLGWFERMIRTLREAPETGSGSTTHIDVAMPPGVLAH
RADGRTATMVFLHNLGTEDVEVDLSTLAPEADLPIDVLSDRNYEDVGKLDRLKLGGYGYR
WIRLCRGHER
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaggtggtatcaggaggcggtcgtctactgcctcgacgtcgacactttcgcg
gactccgacggcgacggggtgggtgacttccagggcctgatcgggcgcctggactacctg
gcccggctcggggtgacgtgtctctggctgaacccgatccatccctcgccgaacgaggac
gacgggtacgacgcgaccgacttctacaacgtcgacccgcggctgggcacgctcggcgac
ttcgccgaactgctgcaccaggcgagcaacaggggcatccgggtgatcatcgatctggtg
gtcaaccacacctcggaccagcacccgtggttccagtccgcccggtcctcgcccgactcg
ccgtaccgggactggtacgtctgggccgaccacgagccggccgaccgccaccagggcatg
gtcttcccgggcgagcagcacgagacgtggacctacgaccggaccgccaaggcgtggttc
taccaccgcttctacaagttccagccggacctgaacatcgagaatccgaaggtccgcgcg
gagatcaagaagatcacgtcgttctggctccagctcggcgtcgccggcttccggatggac
gcggtgccgttcatcatcgagcgcaccgagccgggcaacccgaactcgccgaaggacttc
gacttcatcaccgacctccggcagcacgtgcagtggcggcgcggcgacgcggtcctgctg
gccgaggcgaacgtcgagccggacgagctgcccgtctacttcggcgacggcagcggctcg
ggcaaccggatccacatgctcttcgacttcatgctcaacggccggctgatgctcgccctg
gcccgggaggacccggaggtgatcatcgaggcgctgcgcgacaccccgaagctgcccacc
ggcggccagtgggcgacgttcctgcgcaaccacgacgagatcgacctgtcccggctcacc
gccgaccagcgcaacgacgtgctggcgaagttcgggccggacgagaacatgcagctctac
ggccggggcatccgccgccggctggcgcccatgctcggcaacgaccgccggcacatcgag
ctggcgtactcgctccagttctcgctgcggggcacgccggtgctgcgctacggcgaggag
atcggcatgggggaggacctgtcgctggacggacgcgacgcgatccgtaccccgatgcag
tggtcctacgccgacaacgccggcttctccaccgccgagccggagaagctggtccgcccg
gtcatcgacaagggcgagtacggctaccagaaggtcaacgtcaccgcccagcgcaaggac
ccgcggtcgctgctcggctggttcgagcggatgatccggacgctgcgggaagcaccggag
accggctcgggcagcaccacccacatcgacgtggcgatgccgccgggcgtgctcgcgcac
cgcgccgacgggcgtaccgcgacgatggtcttcctgcacaacctcggcactgaagacgtc
gaggtggacctgagcacgctggcgccggaggcggacctgcccatcgacgtgctgagcgac
cgcaactacgaggacgtgggcaagctcgaccggctcaagctcggcgggtacggctaccgg
tggatccggctctgccggggccacgagcggtag

DBGET integrated database retrieval system