KEGG   Micromonospora sp. B006: MicB006_4249Help
Entry
MicB006_4249      CDS       T05583                                 

Definition
(GenBank) nickel-dependent superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
micb  Micromonospora sp. B006
Brite
KEGG Orthology (KO) [BR:micb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MicB006_4249
Enzymes [BR:micb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MicB006_4249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AXO36518
UniProt: A0A385AX41
LinkDB All DBs
Position
4716299..4716703
Genome map
AA seq 134 aa AA seqDB search
MRLPRILTPRVTASAHCDLPCGVYDPAQARIEAESVKMICEKYQANTDPEFRTRAILIKE
QRADLVKHHLWVLWTDYFKPQHFEKYPHLHQLFNEATKLAGAAGAKGGTDPAKADELLAK
IDEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttccccgcatcctcacgccccgggtgacggccagcgctcactgcgacctgccc
tgcggcgtatacgacccggcccaggcccggatcgaggccgagtcggtcaaaatgatctgc
gagaagtaccaggccaacaccgacccggagttccgtacccgcgccatcctgatcaaggag
cagcgggcggacctggtcaagcaccacctgtgggtgctctggaccgactacttcaagccg
cagcacttcgagaagtacccgcacctgcaccagctgttcaacgaggccaccaagctggcc
ggcgcggccggcgccaagggcggcaccgacccggccaaggccgacgagctgctggcgaag
atcgacgagatctcgaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system