KEGG   Micromonospora sp. B006: MicB006_4389Help
Entry
MicB006_4389      CDS       T05583                                 

Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
micb  Micromonospora sp. B006
Pathway
micb00020  Citrate cycle (TCA cycle)
micb00480  Glutathione metabolism
micb01100  Metabolic pathways
micb01110  Biosynthesis of secondary metabolites
micb01120  Microbial metabolism in diverse environments
micb01130  Biosynthesis of antibiotics
micb01200  Carbon metabolism
micb01210  2-Oxocarboxylic acid metabolism
micb01230  Biosynthesis of amino acids
Module
micb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
micb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MicB006_4389
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MicB006_4389
Enzymes [BR:micb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MicB006_4389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AXO36656
UniProt: A0A385AXF5
LinkDB All DBs
Position
complement(4860653..4861870)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVNNPVVEIDGDEMTRIIWKQIREQLILPYLDVDLHYYDLSIQHRDATDDQVTVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKATDFVVPGPGTVTITYTPADGGTPMEMEVANFPGGGIAMG
MYNYDESIRDFARASFRYGLDRNYPVYMSTKNTILKAYDGRFKDIFAEVFENEFKAEFEA
AGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGR
TVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLAHRGKLDDTPAVTEFANTLEK
VIVDTVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARRLAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaacaacccggtcgtggagatcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcac
tactacgacctgtcgatccagcaccgtgacgccaccgacgaccaggtcacggtcgacgcc
gccaacgccatcaaggagcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcccgggttgaggagttcggcctgaagaagatgtggcggtcgccgaacggcaccatccgc
aacatcctcggcggcgtggtcttccgcgagccgatcatcatgtcgaacgtgccgcggctc
gtcccgggctggaccaagccgatcatcatcggccggcacgcgcacggcgaccagtacaag
gccaccgacttcgtcgtccccggcccgggcacggtgaccatcacctacaccccggccgac
ggcggcaccccgatggagatggaggtcgccaacttccccggcggcggcatcgccatgggc
atgtacaactacgacgagtcgatccgggacttcgcccgcgcctcgttccggtacggcctg
gaccgcaactacccggtctacatgtccaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttcgccgaggtgttcgagaacgagttcaaggccgagttcgaggcc
gccggcctcacctacgagcaccggctgatcgacgacatggtcgccgccgcgctcaagtgg
gagggcgggtacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtg
gcgcagggcttcggctcgctcggcctgatgacctcggtgctgctctccccggacggccgc
accgtcgaggccgaggccgcccacggcaccgtcacccggcactaccggcagtaccagaag
ggcgagaagacctcgaccaacccgatcgcctcgatctacgcctggacccggggcctggcc
caccggggcaagctggacgacaccccggcggtcaccgagttcgcgaacacgctggagaag
gtcatcgtggacaccgtcgagggcggccagatgaccaaggacctcgcgctgctcatctcg
cgggacgccccgtggctgaccaccgacgagttcatgaacgcgctcgacgagaacctggcg
cgccggctcgccgcctga

DBGET integrated database retrieval system