KEGG   Micromonospora sp. B006: MicB006_4706Help
Entry
MicB006_4706      CDS       T05583                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
micb  Micromonospora sp. B006
Pathway
micb00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MicB006_4706
Enzymes [BR:micb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MicB006_4706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF4350 Glyco_hydro_35 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AXO36969
UniProt: A0A385AY96
LinkDB All DBs
Position
5201546..5203558
Genome map
AA seq 670 aa AA seqDB search
MRNWHGEGIWYGADYNPEQWPEQTWAEDVELMRRAGVNLVSVGIFSWALLEPAPGRYVFD
WLDRVIDLLHDGGIGVDLATATASPPPWLAHRHPETLPRRADGAVLWPGGRQAYCPSSPV
FRDHSLALVEAVARRYARHPAVVLWHVSNELGCHNVHCYCDVSAEAFRGWLRERYGDLDS
LNAAWGTAFWSQRYHDWDEINPPRTAPTFANPTQQLDFLRFSSDEQRAQLRAERELLNRL
VPQPVTTNFMIGTGIKYLDYHSWASDVDVVANDHYLTAADPQPHVNLALAADHTRGVAGG
APWLLMEHSTSAVNWQPRNVAKTPGQMRRNSLAHVARGADGVLFFQWRASRAGAEKFHSA
LVPHAGPDTKVFREVCRLGADLRALAEVRGSHVDADVAILFDYEAWWGVELDSHPSVDVT
YTDRLSALHGALWRAGVTADVVHPSADLSRYRLVVVPTLYLTRDADADALRRFVEAGGTA
LVTYFSGIVDEHDHIRLGGYPGAYRDLLGVRVEEFFPLRAGETVRLDDGARADVWTEWLH
AEGAEVLAAYADGPLPGVPALTRNAVGAGAAWYVGTRLDDDATDRLVARLLAETGVRPPV
DAPAGVEVVRRRSAADRSWLFVINHTTEPARLPVTGVELLGGARCDGELEVPAGEVAVVR
EEPAPPPATA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcggaactggcacggcgagggcatctggtacggcgccgactacaacccggagcagtgg
cccgagcagacgtgggccgaggacgtcgaactcatgcgacgggccggggtcaacctggtc
tcggtcggcatcttctcctgggcgctgctggaacccgcccccggccggtacgtcttcgac
tggctggaccgggtgatcgacctgctgcacgacggcggcatcggcgtcgacctggccacc
gccaccgccagcccgccaccgtggctggcgcaccggcacccggagacgctgccccgccgg
gccgacggcgcggtgctctggcccggcggccggcaggcgtactgccccagctcgccggtg
ttccgcgaccactcgctcgcccttgtcgaggcggtcgcccggcggtacgcgcggcacccc
gccgtcgtgctctggcacgtctccaacgaactcggctgccacaacgtgcactgctactgc
gacgtcagcgccgaggcgttccgcggctggctgcgcgagcgctacggcgacctggactcg
ctcaacgcggcctggggcaccgcgttctggagccagcgctaccacgactgggacgagatc
aacccgccgcgtaccgcgccgacgttcgccaacccgacgcagcagctggacttcctgcgg
ttctcctccgacgagcagcgcgcccagctgcgcgccgagcgggaactgctgaaccggctc
gtcccgcagccggtcaccacgaacttcatgatcggcaccggcatcaagtacctggactac
cactcctgggcctccgacgtggacgtggtcgcaaacgaccactacctcaccgccgccgac
ccgcagccgcacgtcaacctcgcgctggccgccgaccacacccggggcgtcgcgggcggc
gcgccgtggctgctgatggagcactccaccagcgccgtcaactggcagccccgcaacgtg
gccaagacgccgggccagatgcgccgcaacagtctcgcccacgtcgcgcgcggcgccgac
ggggtgctgttcttccagtggcgggcctcccgggccggcgccgagaagttccactccgcg
ctggtcccgcacgccggcccggacaccaaggtgttccgcgaggtctgccggctcggcgcc
gacctgcgcgcgctggcggaggtacgcggcagccacgtcgacgccgacgtggcgatcctg
ttcgactacgaggcgtggtggggcgtcgaactggactcccatccgagcgtcgacgtcacc
tacaccgaccggttgtccgcgctgcacggcgcgctctggcgggccggggtcaccgccgac
gtggtgcacccctcggccgacctgtcccgctaccggctcgtcgtggtgcccacgctctac
ctcacccgcgacgccgacgccgacgcgctgcgccggttcgtggaggccggcggtaccgcc
ctggtcacctacttcagcggcatcgtcgacgagcacgaccacatccggctcggcggctac
cccggcgcgtaccgcgacctgctcggcgtacgcgtcgaggagttcttcccgctgcgggcc
ggcgagacggtacgcctcgacgacggcgcccgcgccgacgtgtggaccgagtggctgcac
gccgagggcgccgaggtgctcgccgcgtacgccgacgggcccctgcccggcgtgccggcg
ctgacccgcaacgccgtcggcgcgggtgccgcctggtacgtcggcacccggctcgacgat
gacgccaccgaccggctggtggcccggctgctcgccgagaccggcgtccggccgccggtg
gacgcgccggccggagtggaggtggtccgccgccgctcggcggcggaccggagctggctg
ttcgtgatcaaccacaccaccgagccggcccggctgccggtcaccggcgtcgagctgctc
ggcggcgcccgctgcgacggcgagctggaggtgccggcgggggaggtggcggtggtccgc
gaggagcccgcgccgccacccgcgaccgcctga

DBGET integrated database retrieval system