KEGG   Micromonospora sp. B006: MicB006_5389Help
Entry
MicB006_5389      CDS       T05583                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
micb  Micromonospora sp. B006
Pathway
micb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
micb01100  Metabolic pathways
micb01110  Biosynthesis of secondary metabolites
micb01130  Biosynthesis of antibiotics
micb01230  Biosynthesis of amino acids
Module
micb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MicB006_5389
Enzymes [BR:micb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MicB006_5389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA AAA_33 Cytidylate_kin2 AAA_22 AAA_16 RuvB_N AAA_30 AAA_24 AAA_28 AAA_25 AAA_5 AAA_17 Zeta_toxin AAA_19 CbiA KTI12 DUF2075 AAA_23 AAA_3 Cytidylate_kin cobW RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AXO37651
UniProt: A0A385B090
LinkDB All DBs
Position
5994476..5994985
Genome map
AA seq 169 aa AA seqDB search
MSTRPVCVLVGAPGSGKTTVGTALAEALGVDFRDTDADIENLAGKPIPEIFVDEGEEHFR
TLERAAVAAALASHAGVLALGGGAVLAEENRAALIGHTVVHLSVELPDAVKRIGLGAGRP
LLALNPRATLKHLMDQRRPLYAEVATATVVTDGRTPEELAAEIAALLKP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacccggccggtctgcgtgctggtcggtgcgcccggctccggcaagaccactgtc
ggcacggcgctcgccgaggcgctcggcgtcgacttccgggacaccgacgccgacatcgag
aacctcgccggcaagcccatcccggagatcttcgtggacgagggggaggagcacttccgt
accctcgaacgggccgccgtggcggcggcgctcgcgtcgcacgcgggcgtgctcgcgctc
ggcggcggcgcggtcctggccgaggagaaccgggccgcgctgatcggccacaccgtggtg
cacctgtcggtggagctgccggacgcggtcaagcggatcggtctgggcgccgggcggccg
ctgctcgcgctgaacccgcgcgccacgctcaagcacctgatggaccagcgccgcccgctc
tacgccgaggtggcgaccgcgaccgtggtgacggacgggcgtaccccggaagagctggct
gcggagatcgccgcgctgctcaagccctga

DBGET integrated database retrieval system