KEGG   Microbulbifer aggregans: AUP74_00021Help
Entry
AUP74_00021       CDS       T04560                                 

Gene name
gatB
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
micc  Microbulbifer aggregans
Pathway
micc00970  Aminoacyl-tRNA biosynthesis
micc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:micc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AUP74_00021 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:micc03029]
    AUP74_00021 (gatB)
Enzymes [BR:micc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AUP74_00021 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AUP74_00021 (gatB)
Mitochondrial biogenesis [BR:micc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AUP74_00021 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AOS95501
UniProt: A0A1C9W2Y6
LinkDB All DBs
Position
20572..22023
Genome map
AA seq 483 aa AA seqDB search
MEWEIVIGLEVHVQLSTQSKLFSGASTRFGAAPNTQACAIDLAMPGTLPVPNEEAFRYAV
MFGLAMNAEIGKRSVFERKNYFYPDLPKGYQTTQLAEPIVGSGEIEIHLEDGSSKKVRLH
HAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLIEIVSEPDMRSAAEAVAYLRKVHSIVTYL
GISDGDMSQGSMRCDANVSVRLKGEEELGTRTELKNINSFRFVERAIKIEAQRQIDLIED
GGQVVQETRLYDADKNETRSMRSKEVANDYRYFPCPDLLPVELDDDYIEAIRKQLPELPD
AKSARFASEYGLSAYDADLLTQERASAEFFEAAAGQCGQPKLVANWMMGELAALLNREEI
GIEQSPVSAAQLAGLIERIVDNTISSKIAKQVFEAIANGEGDADTVIEKRGLKQVSDTGA
IEQMVDEVIANSAAQVENYRNADEAKRPKMMGYFVGQIMKASKGQANPQVINKILKEKLD
ALL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaaatcgttatcgggctggaagtgcacgtacagctctccacccagtcaaag
ctattctccggtgccagcacccgcttcggcgcagcccccaacacccaggcctgcgccatc
gacctggccatgccaggcacccttccggtgccgaacgaggaggcgttccgttacgccgtc
atgttcggcctggccatgaacgcggagatcggcaagcgctcggtcttcgagcgcaagaat
tatttctacccggatctgcccaaaggctaccagaccacccagctggcagagcccattgtc
ggctccggggaaatcgaaattcatctcgaggatggcagcagcaagaaagtgcgtctgcac
cacgctcacctcgaagaggacgccggcaagtcgctacacgaagactttcacggcatgtcc
ggcatcgacctgaaccgggccggtacgccgctgatcgagatcgtctccgagccagacatg
cgcagtgccgccgaagcagtggcctacctgaggaaagttcacagcatcgtcacctacctg
ggcatttccgatggcgacatgtcccagggatccatgcgctgcgatgccaacgtatcggtg
cgactgaaaggtgaagaggaactcggcacccgcaccgaactgaagaacatcaattcattc
cgcttcgtcgaacgagccatcaagatagaggcacaacgtcagatcgacctgatcgaggac
ggtggccaggtggtccaggagacccgcctgtacgatgccgacaagaacgagacacgctcg
atgcgcagcaaggaagtggccaatgattaccgctacttcccctgccccgacctgctgcca
gtggagctcgacgacgactatatcgaggccatccgcaagcaactgccagaactaccggac
gcaaagagcgcgcgctttgccagcgaatatggtctgtccgcctacgatgccgacctgttg
acccaggaacgcgccagcgcagaattcttcgaagccgcagcaggacagtgcggccagccg
aagctggtggctaactggatgatgggcgagctcgcggctctgctgaatcgcgaggaaatt
ggcatcgagcagtcgccggtcagtgctgcacaactggcgggcctcatcgagcgcatcgtc
gacaacaccatttccagtaagatcgccaagcaggttttcgaagccatcgccaatggcgag
ggggacgccgatacggtgatcgaaaagcggggactgaaacaggtatcggacactggcgcc
atcgaacagatggtggacgaggtgatcgccaatagtgcggcccaagtggaaaattaccgc
aatgcagacgaagccaagcgaccaaagatgatggggtatttcgttggccagatcatgaag
gcatcgaagggccaggccaacccgcaggtcatcaacaaaattctcaaggaaaaactggac
gcgctgctctga

DBGET integrated database retrieval system