KEGG   Microbulbifer aggregans: AUP74_00294Help
Entry
AUP74_00294       CDS       T04560                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
micc  Microbulbifer aggregans
Pathway
micc00473  D-Alanine metabolism
micc00550  Peptidoglycan biosynthesis
micc01100  Metabolic pathways
micc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:micc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AUP74_00294 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AUP74_00294 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AUP74_00294 (ddlA)
Enzymes [BR:micc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AUP74_00294 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:micc01011]
 Precursor biosynthesis
  Amino acid ligase
   AUP74_00294 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AOS95766
UniProt: A0A1C9W3N5
LinkDB All DBs
Position
335314..336330
Genome map
AA seq 338 aa AA seqDB search
MSQRSPNPIQTLLICGGGSSEHDVSLRTADFIERQLQDVDDIALTRVVMDANGRLTDSKG
GVHFLSQQRQLVAEDGSARDVHYVIPAIHGYPGETGDLQSQLELFGIPYFGCGPEASKTC
FNKITTKLWLTALGIDNTPYQFLCSNNGGEAGKATMALQQWGAVFVKASNQGSSVGCFKV
TEEEQMEEALEQAFALSPYVLVEKCLKVRELEVAAYTYEGELVITPPGEVCAPEDTFYSY
EEKYAEGSRARTFVEAEGLSEAQLGWIHEASKRAFIGLQLKDLSRIDFFLTDEGDIYLNE
VNTFPGMTPISMFPKMLANAGHDFSRYLSSLIREAVAG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgatccccgaacccgattcaaaccctgctgatctgcggtggcggcagcagt
gaacacgacgtctccctgcgcacggcggacttcatcgagagacagctgcaggacgttgac
gatatcgccctcacacgggtggtgatggacgcgaacggccgcctgaccgatagcaaaggc
ggcgtgcacttcctgagccagcagcgccagcttgtagcggaggacggcagcgcccgggac
gtgcactacgtgattccggcaattcacggctaccccggtgaaaccggtgacctgcagagc
cagctggaactgttcggcattccctacttcggctgcggtcccgaggcgagcaagacctgt
ttcaacaagatcaccaccaagctgtggctcacggcactgggcatcgacaacacgccctat
caattcctgtgcagcaataacggcggagaagccggcaaggccaccatggccctgcaacaa
tggggcgcagtcttcgtcaaggcctccaaccagggttcctcagtcggctgcttcaaggtc
acggaagaggaacagatggaagaggcactggagcaggccttcgcgctctcgccttatgtg
ctggtggaaaagtgcctgaaagtgcgggagctggaagtggccgcctacacctacgagggc
gaactggtcatcactccgcccggcgaggtctgcgcgccggaggacactttctacagctac
gaggaaaaatatgccgagggcagccgcgccagaaccttcgttgaagccgaggggctgagc
gaggcacagcttggctggattcacgaggcgtcaaagcgcgcctttatcggcctgcagttg
aaggatctgtcacggatcgactttttcctcaccgacgagggcgatatctacctgaacgag
gtgaacaccttcccgggtatgacgccgatctccatgttcccgaagatgctggccaatgcc
gggcatgatttcagccggtatctctccagcctgattcgcgaagctgtcgccggctga

DBGET integrated database retrieval system