KEGG   Microbulbifer aggregans: AUP74_00585Help
Entry
AUP74_00585       CDS       T04560                                 

Gene name
estB_1
Definition
(GenBank) Esterase EstB
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
micc  Microbulbifer aggregans
Pathway
micc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:micc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AUP74_00585 (estB_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:micc01002]
    AUP74_00585 (estB_1)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:micc01011]
    AUP74_00585 (estB_1)
Enzymes [BR:micc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AUP74_00585 (estB_1)
Peptidases [BR:micc01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   AUP74_00585 (estB_1)
Peptidoglycan biosynthesis and degradation proteins [BR:micc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AUP74_00585 (estB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AOS96055
UniProt: A0A1C9W4I6
LinkDB All DBs
Position
673983..675485
Genome map
AA seq 500 aa AA seqDB search
MRIGIKTAAIVKASVIRLIQDAPVSESGGQISSDANYRSGHPRYPVSLFSIASPQMLLAA
ALLVLPLVSTAPAVAATESERCEYPRLRVADSPESVGFSSAGLARVDELIERDVAAGFPG
AALLIIKDGRIVKNSQYGFRQKFSENKALKPFKPVENSTLFDLASNTKMYATNFALQKLV
SEGQLDLQAPIREYLPEFTDQQGDQIPGKNSLRVIDLLHHSAGFSPDPQYHNPRVAKALF
SQDREKTLGFIPRSPLSHQPGTKTAYSDTDYMLLGLLIERITGEQLDHYVEQQIYAPLGL
ERTKFNPLRKGFTPDQFAATELMGNTRDGAIDFPNIRRQTLLGEVHDEKAFYSMDGVSGH
AGLFSTTSDLAILLQVMLNGGGYGNTCVFSREVIQRFTSPSPLNPTFGLGWRKNANEEMQ
WMFGELASAAAYGHTGWTGTLTIIDPASNLGIVLLTNKKHSPLVDTGKGAYRFLGDLFAT
GRYGPVATSVYEALLPSEPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgggatcaagactgcggccattgtgaaagccagtgtcattcggcttatccaa
gatgcccctgtaagcgagagtggcgggcagatatcctctgacgccaattacaggtccggt
cacccccgatatcccgtcagcctcttcagtattgcatctccgcaaatgctgctcgcggcc
gcgctcctggttttgccccttgtctcgaccgctccggctgtcgctgctacggaaagtgaa
cgctgtgaatatccgaggctgcgtgtggcggatagcccggagtccgtcggcttctctagt
gccggactggcgagagtcgatgagctgatcgagcgcgacgtggctgccggcttcccgggg
gcggcgctactcatcatcaaagatggccgtattgtcaaaaactcccagtacgggttccga
cagaagttttcggaaaacaaagcactcaagccgttcaagcccgtcgagaacagcaccctg
tttgaccttgcatcaaacaccaagatgtatgccaccaactttgccctgcaaaaattggtc
agcgagggccagctggacctgcaggcgccgatccgcgaatacctgcccgaattcactgac
caacaaggcgatcaaattcccggaaagaacagtctgcgagtgatcgatctgctgcatcat
tctgcaggcttttccccagacccccaataccataatccgcgagtggcaaaagccctcttt
tcgcaagacagggaaaagactctcggcttcataccccggtcgccgctcagccaccaaccg
ggaaccaaaactgcttacagcgatacggactatatgctgctcggtctgttgatcgagcgc
attacaggggagcagctggatcactacgtagaacaacagatctacgcgccgctcgggctc
gagcgcaccaagttcaatccactgcgcaaaggattcactcctgaccagttcgccgcaacc
gaactgatgggcaatacccgagacggagcgatcgattttcccaatatccgccgacaaacg
cttttgggcgaggtgcacgacgagaaagccttttattcaatggatggtgtctctggacat
gctgggctgttctccaccaccagcgacctggccatattacttcaggtcatgctcaatggt
ggcggctatggcaatacctgcgtgtttagccgtgaggtcatccagcgcttcaccagcccg
tctcccctgaatccgacgttcggcctcggctggagaaagaatgccaacgaggaaatgcag
tggatgtttggagaactggccagcgcagcggcctacggccacacaggctggaccggcaca
ttgacgatcattgatcccgcttccaatctcggcattgtattgctcaccaacaagaagcac
tcaccactggtcgacaccggtaaaggggcttatcgattcctcggtgatctctttgctacc
ggccgctacggcccagttgcaaccagcgtctatgaagcgctactgccgtcggagccccgc
tga

DBGET integrated database retrieval system