KEGG   Microbulbifer aggregans: AUP74_00597Help
Entry
AUP74_00597       CDS       T04560                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase precursor
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
micc  Microbulbifer aggregans
Brite
KEGG Orthology (KO) [BR:micc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AUP74_00597
Enzymes [BR:micc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AUP74_00597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase SecA_DEAD
Motif
Other DBs
NCBI-ProteinID: AOS96067
UniProt: A0A1C9W4J1
LinkDB All DBs
Position
complement(696492..698033)
Genome map
AA seq 513 aa AA seqDB search
MRTLFSLRLFTVIAFVFTAGVTSANEFQSGLQSTLEREFSRLKGVPGVAVGVATPDQGTV
FAGAGVGNTLTGSPVSAADQFRIASISKVFTGAMVLKLQEQGYLNIDDRLIDHLFIPGLP
YGDVMTIRQLLNHSAGVYDHINGSNNFWSLALDDPYRIWDSSEIVQYAIDGGALAAPGTA
YNYSNTGTYILGMLIEAKTGLSLSAAVDQMVSVPLQLPGLFLDDWSNPQQKIVGLAENDR
AYEFHKSGIGAAGAMVAPAEQLAAFGRSVYGANFLPSELTEMMTAPSLRNSSYGLTTRIW
SEATYGYLHFGHTGTLSGYSSILMYVPDQDVAIGILSNGYARSSSSWYTLIDEIFNYVTS
WYASNGSGACTIPEADDIIIDNADTAMNVSGSWQTDSRGKKHYGADYLTDGNAQKGELVA
SYQFSAPGAGVWELMEYHPASRDQATQTPVTVIVSGGAQSFVIDQSAAGSSWNSLGQISL
LAGQDLEVALSNNGTDGTVVADAFRLRFSACPE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagaacattattttccctcaggctattcaccgttattgcttttgtttttaccgctggc
gttacgagtgccaatgaatttcaaagtgggctacagagcacactggagagagaattttcc
cgattgaagggggtgcccggtgtggcagttggcgtggcaactcccgaccagggaacagtc
tttgccggggcaggggtaggtaacaccctgacaggcagtccggtatctgctgctgatcag
tttcgcattgcgagtatcagcaaagtatttactggcgcaatggtgcttaagctacaggag
cagggttatctcaatatcgatgacagattgatcgatcatctatttattcctgggctcccc
tacggcgatgtcatgaccattcgccagctcctgaatcactccgcgggtgtctacgaccac
atcaatggcagcaataacttctggagcctggctctggacgacccctaccggatctgggat
tcctcagagatcgtgcaatatgcgatcgacggcggtgcgctggctgcaccaggcactgct
tacaactattcgaataccgggacttatattctgggtatgctgatcgaagcaaagaccgga
ttgtctctctcggccgcggtcgaccagatggtatcggttcccctgcagctgccgggtctg
tttctggatgactggagtaacccccaacagaagatagtcggacttgccgagaatgatcgt
gcctatgaattccacaagagcgggatcggcgcggcaggggcgatggtcgctccggcagag
cagttggccgcattcggtcgctccgtttacggtgccaatttcctaccatcagaactgacc
gaaatgatgactgccccttccctcaggaatagtagctatggcctcaccactcggatctgg
tctgaagcgacgtatggctatctacactttggccatacgggcacgctttcgggttacagc
agtatcctgatgtacgttccggatcaggatgttgcgatcggcattctcagtaatggctat
gccagaagttcgtcgagctggtacacgttgattgatgagattttcaattacgtgacctcc
tggtatgccagcaatggcagcggtgcttgtaccattccagaggccgacgacatcatcatc
gataatgctgatactgctatgaacgtgagcggtagctggcagacggattcaaggggcaag
aagcactatggtgccgactacttgacggacggcaatgcccagaaaggtgagctggtagcc
agctatcagttttctgccccgggagccggcgtctgggagctgatggaataccatcccgcg
tctcgcgaccaggctacccagacaccggtgactgtcattgtttcaggcggtgcgcagtcg
ttcgtgattgaccagagtgctgcgggaagtagctggaatagtctgggtcaaatctcactc
ttggcagggcaagatctcgaagtagcactctcgaacaatggaacagatggcaccgtggtt
gcggatgcgttccgcttgcgcttcagcgcctgccctgaataa

DBGET integrated database retrieval system