KEGG   Microbulbifer aggregans: AUP74_01978Help
Entry
AUP74_01978       CDS       T04560                                 

Definition
(GenBank) Angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
micc  Microbulbifer aggregans
Brite
KEGG Orthology (KO) [BR:micc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:micc01002]
    AUP74_01978
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:micc04147]
    AUP74_01978
   04090 CD molecules [BR:micc04090]
    AUP74_01978
Enzymes [BR:micc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AUP74_01978
Peptidases [BR:micc01002]
 Metallo Peptidases
  Family M2
   AUP74_01978
Exosome [BR:micc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AUP74_01978
CD molecules [BR:micc04090]
 Proteins
  AUP74_01978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Reprolysin_5 Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: AOS97408
UniProt: A0A1C9W8E5
LinkDB All DBs
Position
2267160..2269043
Genome map
AA seq 627 aa AA seqDB search
MKKLALAIAATVVFAGCDSGETGKETTQPTNAAAQVSSEAAQGAQNGGDLTAADAKAFLE
EAQSRLAEMAEELSHASWLASTYINTDSQYVESLASERFTSLAVELANEAAQFDDLQLDA
ETRRQLTMLKQALVLPAPKDPKLTAELAQIQSKLQGMYGSGKYCTGEGDAEKCYSLTEMG
RLMAESRDPEQLKDLWVGWRKVSPPMKPLYERQVEIANAGAQELGYDNLSVMWRSKYDMG
ADDFAADMDNQWNKVKPLYKALHCHVRAKLNERYGDDVVPPNGKIPAHLLGNMWAQEWGN
VYDVVKDEDMEAPYDLDALIQDSGMSEKDMVKVGEKFFTSLGFKPLPETFWERSQFTKPR
DRDVVCHASAWNLDSKDDIRIKMCIQKTADDFITVHHELGHNFYQRIYKDQPFLYREGAN
DGFHEAVGDAIALSITPKYLKEIGLMDEVPGSDKDIGFLMRQALDKIAFLPFGLMVDKWR
WQVFDGEVQPGDYNKAWWKLREDYQGIQAPVARTEADFDPGAKYHIPGNTPYARYFLARI
QQFQFHRALCEAAGEQGPLHRCSIYNNEAAGEKLRDMLAMGASKPWPDAMEAITGQRELD
ASAIIDYFQPLMAYLEEQNKDRQCGWE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacttgctctggcgattgcggccacagtggtttttgccggttgtgatagcggc
gaaaccggaaaagagactacccagccgacaaatgctgcggcccaggtgagcagtgaggcc
gcccagggtgcccagaacggcggcgatctgaccgcggctgatgccaaggcgttcctggag
gaagcccagtcccgcctggccgagatggcggaagagctgagccatgcgagctggctggcc
tccacctacatcaataccgactcccagtatgtggagtccctcgcctccgagcgtttcact
tccctggccgtggagctggctaacgaggcggcgcagtttgacgacctgcagttggatgct
gaaacccgccgccagctgaccatgctgaagcaggcactggttctgccagcgcccaaggac
ccgaaactcaccgcggaactggcccagatccagtccaagctgcagggcatgtacggttcc
ggcaagtactgcaccggcgagggtgatgcagagaaatgctacagcctgaccgagatgggt
cgcctgatggccgagagccgcgatccggaacagcttaaggatctgtgggttggttggcgc
aaggtgtccccgccgatgaaaccgctttacgaacgccaggtggagatcgccaatgccggt
gcgcaggagctgggctatgacaacctcagtgtcatgtggcgctccaagtacgacatgggt
gccgatgactttgccgcggacatggacaaccagtggaacaaggtgaagcctctgtacaag
gcgctccactgtcacgtgcgggccaagctcaacgagcgctatggtgatgacgtggtgccg
cccaacggcaagatccccgcacacctgctcggtaacatgtgggcccaggagtggggcaat
gtctatgacgtcgtcaaagacgaggatatggaggcgccctacgacctcgatgcgctgatc
caggattctggcatgagcgaaaaggatatggtcaaggtgggtgagaagttcttcacctcg
cttggcttcaagccgctgcccgaaactttctgggagcgctcccagttcaccaagccccgc
gaccgcgatgtcgtctgccatgccagtgcctggaacctggacagcaaggatgatatccgc
atcaagatgtgtatccagaagacggccgatgatttcatcaccgtgcaccacgagctgggc
cacaacttttaccagcgcatctacaaagaccagccgttcctctaccgcgaaggcgccaat
gatggtttccacgaggcggtgggcgatgccattgcactgtccattacgccgaagtacctg
aaggaaattggcctgatggacgaggtgcccggcagcgacaaggacatcggcttcctgatg
cgccaggcgctggacaagatcgccttcctgccgttcggtctgatggtggataagtggcgc
tggcaggtattcgatggcgaggtacagccgggcgactacaacaaggcctggtggaagctg
cgcgaagattaccagggcatccaggccccggtagcacgcactgaggcggactttgatccg
ggtgcgaaatatcacattcctggcaacaccccgtacgctcgttacttcctggcgcgtatt
cagcagttccagttccaccgcgctctgtgtgaagccgccggcgagcagggaccgctgcac
cgctgttccatctacaacaacgaagcggccggcgagaaactgcgcgacatgctggccatg
ggcgcaagcaagccgtggccggatgccatggaagcgattaccggtcagcgtgagctggat
gcctctgccatcattgactacttccagcccctgatggcgtacctggaagagcagaacaaa
gaccgccagtgcggctgggaataa

DBGET integrated database retrieval system