KEGG   Microbulbifer aggregans: AUP74_02258Help
Entry
AUP74_02258       CDS       T04560                                 

Gene name
fadA_2
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
micc  Microbulbifer aggregans
Pathway
micc00071  Fatty acid degradation
micc00280  Valine, leucine and isoleucine degradation
micc00281  Geraniol degradation
micc00362  Benzoate degradation
micc00592  alpha-Linolenic acid metabolism
micc01100  Metabolic pathways
micc01110  Biosynthesis of secondary metabolites
micc01120  Microbial metabolism in diverse environments
micc01130  Biosynthesis of antibiotics
micc01212  Fatty acid metabolism
Module
micc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:micc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AUP74_02258 (fadA_2)
   00592 alpha-Linolenic acid metabolism
    AUP74_02258 (fadA_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUP74_02258 (fadA_2)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AUP74_02258 (fadA_2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUP74_02258 (fadA_2)
   00642 Ethylbenzene degradation
    AUP74_02258 (fadA_2)
Enzymes [BR:micc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AUP74_02258 (fadA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOS97667
UniProt: A0A1C9W929
LinkDB All DBs
Position
2576279..2577454
Genome map
AA seq 391 aa AA seqDB search
MSLNPRDAVIVDYARTAMGRSKNGVYRHVRADDMSAELLKKFLQRNEKLDPAEIDDLIWG
CVMQRDEQGFNVARFILLRAGLPHTIPAQTVNRLCGSSMSSLHTAAANIRAGVGDVYVVG
GVEHMGHLNMMEHVSPNPMLGRHMAKAAGSMGMTAEYLAMMHGIQRQQMDEFGARSHQRA
AAATKEGKFNREIIAIEGHDDNGVPFLVETDQTIRPDTTVEGLAQLKPAFDPKHGQVTAG
TSSQITDGASVMLVMSAERAKALGLEPIAKVREMALAGVDPSIMGYGPVPSTQKALKSAG
LTIEDIDKVELNEAFAAQALPVLKDLNLLDEMDKKVNLYGGAIALGHPFGCSGVRITGTL
LSVMQNEGGNLGVSTMCIGLGQGITTIVERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaatcccagagacgccgttattgtcgattacgcccgcacggccatggggcgc
tccaaaaacggtgtgtaccgtcatgtccgcgccgacgatatgtccgcagagctgctgaaa
aaattcctgcagcgcaacgagaaactggatccggccgaaatcgacgacctgatctggggc
tgtgtgatgcagcgggatgagcagggcttcaacgtggcccgctttattctgctgcgcgcg
gggctgccccacaccatccccgcccagacggtaaaccgcctgtgcggatcctccatgtcc
tccctgcacactgcggcagccaacatccgtgccggtgtcggagatgtctacgtagtgggc
ggtgtcgagcacatggggcacctcaacatgatggagcatgtgagccccaatccgatgctg
ggtcgacacatggccaaagccgcgggttccatggggatgactgccgagtacctggcgatg
atgcacggcatccagcgccagcagatggacgagtttggtgcgcgctcccaccagcgtgcc
gctgcggccaccaaggaaggcaagttcaacagggaaatcatcgccattgaagggcatgat
gataatggtgtgcctttcctggttgaaacggatcagactatccgccctgacaccaccgtc
gagggcctggcacagctgaagcctgcgttcgatcccaagcacggccaggtgacagccggt
acttcctcccagatcaccgatggcgcctccgtaatgctggtgatgtcggcggagcgggcc
aaggcgctgggtctggaacctatcgccaaggtgcgcgagatggcgctggcaggcgtggac
ccgtccatcatgggatacggccctgtgccctccacccagaaggcgctgaagagtgctggt
ctcacgatcgaggatatcgacaaggtcgaactcaacgaggccttcgcggcccaggccctg
ccggtactcaaggatctgaacctgctggacgagatggacaagaaagtgaacctttacggt
ggcgccatcgcgcttggccaccccttcggctgctccggtgtgcgtattactggcacactg
ctttccgtcatgcagaacgaaggcggtaacctgggcgtatccaccatgtgtattggtctc
ggccagggtatcaccactatcgtcgagcgcgtctaa

DBGET integrated database retrieval system