KEGG   Microbulbifer aggregans: AUP74_02291Help
Entry
AUP74_02291       CDS       T04560                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
micc  Microbulbifer aggregans
Brite
KEGG Orthology (KO) [BR:micc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AUP74_02291 (ahpF)
Enzymes [BR:micc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AUP74_02291 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO NAD_binding_8 Thi4 FAD_binding_3 Glutaredoxin AlaDh_PNT_C K_oxygenase Thioredoxin_4 DUF3053
Motif
Other DBs
NCBI-ProteinID: AOS97699
UniProt: A0A1C9W969
LinkDB All DBs
Position
complement(2614787..2616376)
Genome map
AA seq 529 aa AA seqDB search
MLDANLKKQLDTYLQNIVNPIEIRVSSDNSPKSAELESLADQIAELSQKIETRQGSAKRT
PSMAIAPAGEEPRVSFAGIPLGHEFTSLVLALLQNGGHPSKADPAVLDQIRGLEGEYHFE
TYISLSCQNCPDVVQALNLMATLNPNITHEMIDGALFQQEVEQRNIMAVPSVYLNGEHFG
QGRMTLQEIVDKLDTGAAERKVDELNARDPYDVLVVGGGPAGAAAAIYAARKGIRTALVA
ERFGGQVMDTVGIENFISVPYTEGPKLAAGLEQHVKEYGVDIISEQRAASIQRRQLLELE
LESGATLASRSVVLATGARWRELGVPGEAEYRTRGVAYCPHCDGPFFKGKHVAVIGGGNS
GIEAAIDLAGIVKHVTVLEFADTLRADDVLVRKARSMGNVDIITNAQTTEVLGDGNKVTG
LRYTDRVNGNSVDIELAGVFVQIGLVPNTEFLQESDIELNRMGEVVIDERGATSLPGVFA
AGDATTVPYKQIVISMGAGATAALGAFDYLIRHSEDADQEEAAGLANIA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcaaacctgaagaaacaactggacacctatctgcagaatatcgtcaatccg
atcgagatccgtgtgtccagcgacaacagccccaagtcagcggaactggaatccctcgcg
gaccagattgccgaactctcgcaaaaaattgagacccgtcagggcagcgcaaagcgcacg
cccagcatggctattgcgccggcaggcgaggagccccgggtcagctttgccggaataccg
ttgggccacgaattcacctcgttggtgctggccctgctgcagaatggaggccacccgtca
aaggccgatccagcggtactggaccagattcgcggcctcgagggcgaataccattttgaa
acctatatctcactgtcgtgccagaactgcccggatgtggtccaggccctgaatctgatg
gcgacactgaacccgaatatcacccacgagatgatcgacggtgccctgttccagcaggaa
gtcgaacaacgcaacatcatggcagtgccctccgtctacctgaacggcgagcacttcggc
cagggccgcatgaccctgcaggagatcgtggacaagctggataccggcgcggccgagcgc
aaggtcgacgaactgaacgcgcgcgatccgtacgacgtgctggtggtgggtggcggcccc
gccggtgctgccgcagccatctatgccgcgcgcaaaggcattcgcaccgcgctcgtcgcc
gagcggttcggcggccaggtaatggatactgtcggtatcgaaaactttatctccgtgccc
tacaccgagggtcccaaactcgccgccggactcgagcagcacgtgaaggagtacggtgta
gacatcatcagcgaacaacgcgcagccagcattcagcgcaggcaactgttggagctggag
cttgagagcggtgccacccttgccagtcgctctgtggtcctcgccaccggcgctcgctgg
cgcgaactgggcgtgcccggcgaggcggagtaccgcaccagaggcgtagcatactgcccc
cattgtgatggccccttcttcaagggcaagcatgtcgcagtcatcggtggcggtaactcc
ggcatcgaggccgccatcgacctggcgggtatcgtcaagcatgtgaccgtgctggaattc
gccgataccctgcgcgccgacgacgtactcgtgcgcaaggcccgctccatgggcaacgtc
gatatcatcaccaacgcccagaccaccgaggttctcggggacggcaacaaggtcaccggc
ctgcgctacaccgatcgtgtgaacgggaatagcgtggacattgaactggccggtgtgttc
gtacagatcgggctggtgccgaacaccgagttcctgcaggaaagcgatatcgagctgaac
cgcatgggtgaagtcgtcatcgacgagcgcggcgcgacttcactgcccggtgtatttgcc
gcgggcgacgcgactactgtgccctacaagcaaatcgtgatttccatgggcgcaggcgcc
actgcggcactgggtgccttcgactacctgatccgccactctgaggacgcggaccaggag
gaggcagctggtctcgccaacatcgcctga

DBGET integrated database retrieval system