KEGG   Microbulbifer aggregans: AUP74_02381Help
Entry
AUP74_02381       CDS       T04560                                 

Gene name
stkP_3
Definition
(GenBank) Serine/threonine-protein kinase StkP
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
micc  Microbulbifer aggregans
Pathway
micc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:micc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AUP74_02381 (stkP_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:micc01001]
    AUP74_02381 (stkP_3)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:micc02044]
    AUP74_02381 (stkP_3)
Enzymes [BR:micc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AUP74_02381 (stkP_3)
Protein kinases [BR:micc01001]
 Serine/threonine kinases: Other
  Bacterial family
   AUP74_02381 (stkP_3)
Secretion system [BR:micc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AUP74_02381 (stkP_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Pkinase Pkinase_Tyr PEGA CarboxypepD_reg Pkinase_fungal APH Kinase-like Kdo Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AOS97783
UniProt: A0A1C9W9K0
LinkDB All DBs
Position
complement(2715774..2718215)
Genome map
AA seq 813 aa AA seqDB search
MEVVSSGTTSLEIPGYRILKKINQGGMSTVYLAVQRSVGRQVALKVMSPVLNADPIFSER
FQREANIVGQLSHPNIVAIHDIGRYRSLNYIAMDYMPGGSVSDRLAKGIMDPIEALNVAR
QIALALDHAHGKGYVHRDLKPENILFREDGSAVLTDFGVARAVARTTRMTNTGMVVGTPH
YMSPEQARGAAIDGRADLYSLGVVFFEMVTSAVPYQADEAVAIAIKHLTDPIPRLPARHS
LFQGLVERLLAKDPADRFQRGLDVVEAIDQLLAALAGKPTTQATQLNNTAVGPSSLMRAL
LMTLWGTLVDKIAALWARVRDKPLDRHHPRAEQDTIMRIQQVIQQAPQRKRRQWFAGTLA
IAALAASGLLYGIWGDHLPWRAEGAAAINSAVPVADRAAAPEISADQPVIRSAQITPLLQ
RAGTSEAVPESMEGLRPPMRPATQLPEKAERATGPEATTAVSEQPAAAPDEQKVQPEPEV
STAKTTESRIPATEPVLEQLRLRINTQPEQALVRIMNIVPRYRYGMALPPGRYDVEVSRP
GYKTVRRWVSLEEDDLTLQVKLERGYRPGTTLRSPLAGGGNGPEMVVVRAGTFRIGNSRQ
PFTSPVQRIEIAKPFAISAHEITFDEYDRFADATGAALPGDSGWGRGDRPVINVSWEDAR
AYARWLSRETGKRYRLPSEAEWEYAARAGSSTPFWWGNQKARGKANCRRGCASDFVGFFK
ATSAPVGHYLPNSFGLHDTAGNVAEWVQDCYLGDHSGARRDGGPVRINNCDLRVVKGGSM
QDPLTNVSSAYRKGLQQKSLSTDVGFRVLMEIN
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgtcagctcgggcacaacatcactggagattcccggatatcggattctgaag
aagatcaaccagggcggcatgtccactgtctacctggcggttcagcgcagcgttggccgc
caggtcgctctcaaggtcatgtcaccggtgctgaatgccgatccgatcttcagcgagcgc
ttccagagagaggccaacatcgtcggccagctctcccaccccaatatcgtcgccattcat
gatatcggccgctatcgcagcctcaattacatcgccatggactatatgcccgggggctcg
gtttccgacagactggccaaggggatcatggatccgattgaggccctgaatgtggcccga
cagattgcgctcgccctggatcatgctcacggcaaaggttatgtacaccgtgatctgaaa
cccgagaatatccttttccgcgaagacggctccgccgtgttgaccgattttggtgttgcc
cgggccgtcgcccgcacaacccgaatgaccaataccggcatggtggtgggtacgccccac
tacatgagcccggagcaggcccgcggtgccgcgatcgacggccgtgccgatctctacagt
ctcggcgtggtgtttttcgagatggtgaccagtgccgtgccctaccaggccgatgaggcc
gtggccattgccatcaagcacctgaccgacccgatcccccgactgccagcccgccactct
ctgtttcaggggctggtagagcggctgctggccaaggatcctgcagaccgcttccagcgt
gggctggacgtagtggaggcgatcgatcagctgctcgcagcactggcgggaaagcccacc
acccaggcgacgcaactgaacaacaccgccgtcggtccctcgagcctcatgcgcgctctg
ctgatgacactctggggcacactggtagacaagatcgccgcactctgggcccgcgtgcgg
gacaaaccgctggaccggcatcatccccgtgccgagcaggacacgatcatgcggatccaa
caggtgatccagcaggccccacagcgcaagagacgccagtggtttgccggcacccttgct
atcgctgcgctggccgctagcggcctgctgtatggaatctggggcgaccatctaccctgg
cgggccgaaggcgcagcagccatcaacagtgcagttccggtggccgaccgggcagcagcg
ccagaaatttccgcagatcagccggtgatccgatctgcccagatcaccccgctactccag
cgcgcgggaaccagtgaagccgttccagaatcaatggaaggactccgaccaccgatgcgc
cccgcgacacagttaccagagaaagcggaacgggctacaggaccggaagcgaccaccgca
gtgagcgagcagccggccgcggcgccagacgagcagaaggtacaacctgaacccgaggtc
tcaaccgccaagacaacagaaagccggataccagcaacggagcccgttcttgagcagctc
agactcaggatcaacacgcaaccggaacaggctctggtccggatcatgaacatcgtgccc
cgctatcgctatggcatggccctgccgccgggcagatacgatgttgaggtgagcaggccg
ggctacaaaaccgtacgccgctgggtcagcctcgaggaagacgatctcactctgcaggtc
aaactcgagcgcggctaccgccccggcactacactccgcagcccccttgccggtggaggc
aatggtccggaaatggtcgtggtcagggccggaacattccgaataggcaacagccgacaa
ccattcacgagcccggtgcagcgcattgagatagcaaagccctttgcgatctccgcccac
gagatcacgtttgacgaatacgaccgttttgccgatgccaccggcgcagccctgcccgga
gatagcggctggggccgcggcgacaggccggtgatcaatgtgagctgggaagacgcgcgg
gcctatgcccgctggctctccagggaaaccggtaaacgctaccgcttaccgagcgaagca
gagtgggaatatgcagcgcgggccggaagctccacgccattctggtggggcaaccaaaag
gcaagaggcaaagccaattgccgccgcggatgcgccagcgactttgtcggttttttcaaa
gccacgagcgctccggtcggccactatctccccaacagcttcggcttacatgataccgcc
ggcaatgtggcggaatgggtccaggattgctacctgggagatcatagtggtgcccgccgt
gatggcggcccggtgcgcatcaacaactgtgacctgcgcgtggtgaaaggtggctccatg
caggatccgcttaccaatgtcagctctgcctatcgcaaggggctgcaacagaaaagcctg
tccacggatgtaggtttccgcgtactaatggaaatcaattaa

DBGET integrated database retrieval system