KEGG   Microbulbifer aggregans: AUP74_02440Help
Entry
AUP74_02440       CDS       T04560                                 

Gene name
polB
Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
micc  Microbulbifer aggregans
Brite
KEGG Orthology (KO) [BR:micc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:micc03400]
    AUP74_02440 (polB)
Enzymes [BR:micc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AUP74_02440 (polB)
DNA repair and recombination proteins [BR:micc03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AUP74_02440 (polB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2
Motif
Other DBs
NCBI-ProteinID: AOS97842
UniProt: A0A1C9W9L1
LinkDB All DBs
Position
2784800..2787202
Genome map
AA seq 800 aa AA seqDB search
MPQGFLLSRHSFDQRGSTCIHYWLATPEGPVKLVIEGERPVFMVKVADRTTVTESLAGVP
YDWQQLGFQTFGREEAAMLYFPTIDAHRRAQTLLQHRAIEVFEADFRLHDRYLMERFARG
GLYFEGQARAKDGYTEYRQVRLKGAEVQPEFKVVSLDVECSGQGELYSVGLYGHGVEEVL
MVGQPESADTTIHWVDDERALLEALEARIQSLDPDIIIGWAVVDFDFRLLLKRAGRHGLR
LKLGRGGTDARWRDGREGNQGFVTLPGRVVLDGIDGLKSATYNFESFSLEFVSQTLLGRG
KDTEDVDNRLAAIEHDFRHNKPKLAAYNLEDCRLVWDIFQHTRLLDYLRLRAQLTGLELD
RSGGSVAAFTNLYLPKLHRSRYVAPNLPADGGLASPGGYVMDSRPGLYENVLVLDFKSLY
PSIIRTFKIDPMGLVEGLAEGVGEGTTEGSEGGRADDNSIPGFRGARFSRDKHFLPDIIT
NLWAQRDIAKQEQDAARSQAIKIIMNSFYGVLGSGGCRFYDTRLASSITLRGHEIMQQTA
SWIEEIDGGKHQVIYGDTDSTFVWLSGRPSPEEADAIGKRLAREINTRWQNKLKDELALE
CELELEFETHYLRFLMPTIRGSEAGSKKRYAGLVVNGDEEKLVFKGLETVRSDWTALAKQ
FQTQLYGMVFHGEDPSEYIRETVEKTRAGEMDEQLVYRKRLRRKLEQYIKNVPPQVRAAR
LADEHRRQQGLSPRYRNKGWIRYVITLNGPEPVDYRQSPIDYQHYIDRQLKPVADAILPF
IELDFDSLVDGQLGLFGGTE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcaaggattccttctcagtcgccacagctttgatcagcgcggcagcacctgcatc
cactactggctggccacgcccgagggcccggtcaaactggtcattgaaggtgagcgcccg
gtctttatggtgaaggtggcggaccgcaccacggtgaccgagtctctggccggcgtgccc
tacgattggcagcagctgggcttccagacctttggccgcgaggaagcggccatgctctat
ttccccaccatcgacgcccaccgccgggcccagaccctgttgcagcatcgcgctatcgag
gtgtttgaagcagattttcgtctccacgaccgttacctgatggagcgctttgcccgcggt
ggcctctactttgaggggcaggcccgggccaaggatggctatacggaatatcggcaggtg
cgcctcaagggcgccgaggtgcagccggagttcaaggtggtttctctggacgtggagtgc
tccggccagggtgagctgtattccgtcggtctctacggtcatggcgtggaagaggtgctg
atggtgggccagcctgaaagtgctgacaccaccatccactgggtggatgacgaacgtgca
ctgctcgaggctctggaggccaggatccaaagcctagacccggacatcatcatcggctgg
gctgtggtggactttgattttcggctgttgctgaaaagggccgggcgtcatggcctgcgt
ctgaagctgggacgcggtggcaccgatgcccgctggcgggatggccgggaagggaaccag
ggcttcgtgacgctgcccggccgggtggtgctggacggcatcgacggactgaagagcgcc
acctacaactttgaaagcttcagcctggagttcgtgtcccagacgctactgggccgaggc
aaagacaccgaagacgtggacaaccgcctggcggcgattgagcacgactttcgccataac
aaacccaagctcgccgcctacaacctggaagactgccgactggtctgggacatattccag
cacactcgcttgctggattacctgcgcctgcgggcccagctcacgggcctggagctcgac
cgcagcggcggctcggtggcagcctttaccaacctctacctgcccaaactacaccgtagc
cgctatgtggcgcccaacctgccggccgatggcggccttgccagcccaggcggctacgtg
atggactcccggcccggcctttacgagaacgtgctggtgctggacttcaagagcctgtat
cccagcattatccgcaccttcaagatcgatcctatgggcctggttgaaggtttggctgag
ggagtaggtgagggtacgactgagggatcggaagggggccgggcagatgacaacagcatc
cccggttttcgcggcgcgcgcttttcccgtgacaagcacttcctgcccgacatcattacc
aacctctgggcccagcgggacatcgccaagcaggagcaggatgccgcccgctcccaggcc
atcaagatcatcatgaactccttctacggggtactgggaagtgggggctgccgtttttac
gacacacgcctggccagctccatcaccctgcgcggtcacgagatcatgcagcagacggcc
agctggattgaggagattgatggagggaaacatcaggtcatctacggcgataccgattcc
acctttgtctggctgagcggccgaccgagcccggaagaggccgacgcgatcggcaagcgt
ctggcccgcgagatcaacacacgctggcagaacaagctcaaagacgagctggcgctggag
tgcgaactggagctggaattcgaaactcactacctgcgctttttgatgcccaccattcgt
ggctcggaggccggctccaagaaacggtatgcgggcctggtggtgaacggagatgaggaa
aagctggtattcaagggtctggaaacggtgcgtagcgactggaccgccctggccaagcag
ttccagacccagctctacgggatggtgtttcacggtgaagacccgtccgaatatatccgc
gagacggtggagaaaacccgggcaggggagatggacgaacagctggtgtatcgcaagcga
ctcaggcgcaagctggagcaatacatcaaaaacgtgccaccccaggtgcgcgccgcgcgg
ctggccgatgaacaccgccgccagcaggggctgtctccccgctaccggaacaaaggctgg
attcgttacgtgatcaccctcaatggcccggagcctgtcgattaccgtcagtcaccgatc
gattatcagcactacatcgacaggcagctcaaaccggtggccgatgccatattgcccttc
atcgaactggattttgacagcctggtggatggccagctgggcctgttcggaggcaccgag
tga

DBGET integrated database retrieval system