KEGG   Microbulbifer aggregans: AUP74_02669Help
Entry
AUP74_02669       CDS       T04560                                 

Definition
(GenBank) hypothetical protein
  KO
K01884  cysteinyl-tRNA synthetase, unknown class [EC:6.1.1.16]
Organism
micc  Microbulbifer aggregans
Pathway
micc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:micc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AUP74_02669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:micc01007]
    AUP74_02669
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:micc03016]
    AUP74_02669
Enzymes [BR:micc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     AUP74_02669
Amino acid related enzymes [BR:micc01007]
 Aminoacyl-tRNA synthetase
  Other
   AUP74_02669
Transfer RNA biogenesis [BR:micc03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AUP74_02669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: AOS98065
UniProt: A0A1C9WA99
LinkDB All DBs
Position
3041590..3042588
Genome map
AA seq 332 aa AA seqDB search
MILIQRAAVWFLPLLLLACDLDEVPSFVPESSVTNYRLEMRELVQDISRYARSRNRDFII
VPQNGVELVTATGRVTGAVETEYLAALDGIAQQGVFFGLETVDQPSSATESERLRGFLDI
ARDEGGVTVFSTDFAVTERNVDESILLNEEAGYLGFAAPRAELDTIPDYPAVIPNSNRAD
IEDLGFSRNFLHLTNPQLFSTAQELVDAVVETDYDVVIIDFFFIGVPFTAEQIRQLRFKA
NGGRRLLLAYLSVGQAESDRFYWQSFWPSNPPNWLLDEVSGSPGNYHIRYWLQPWRDTLF
GESGDYVDRVIDAGFDGVYMDHIDEFEYFEEL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattttgattcagcgtgccgcggtatggtttttgccgcttctgctactggcctgcgac
ctggatgaggtgcccagcttcgtgccagagtccagcgtgaccaactaccgcctggagatg
cgagagctggttcaggacatcagtcgctacgccagaagccggaaccgggatttcatcatc
gttccccagaatggcgtggagcttgtgactgccaccgggcgcgtcaccggcgcagtggaa
accgagtacctcgcagccctggatggcatcgcccagcagggcgtgttttttggtctcgag
acagtcgaccaaccatcctcagcaaccgaatccgagcgcctgcgcgggtttctggacatc
gcccgcgacgaaggcggtgttaccgtcttctcaaccgatttcgccgtcactgagcgcaat
gtcgacgagtcgatcctgctgaatgaagaggcaggctacctgggcttcgccgccccccgg
gcggaactggacacgataccggactacccggcggtaattccgaacagcaaccgggctgat
atcgaggacctggggttctcccgcaatttcctgcacctcaccaatccacagctgttctcc
accgcccaggaactggtcgatgcggtggtggagacagattacgacgtagtaatcatcgat
ttcttctttatcggagtaccgtttaccgccgagcaaatccggcaactgcgtttcaaggcc
aatggtggccggcgtttgttgctggcatacctcagcgtcggccaggccgagagcgaccgc
ttttactggcagagcttctggcccagcaacccgccgaactggcttctggacgaagtctca
ggttctccggggaattaccacatccgctactggctgcagccctggcgggacaccctgttc
ggtgagtccggggattatgtcgatcgcgttattgatgccgggttcgacggcgtctacatg
gatcacatcgacgagtttgagtatttcgaagagctttaa

DBGET integrated database retrieval system