KEGG   Micromonospora sp. HM134: FJK98_06395Help
Entry
FJK98_06395       CDS       T06145                                 

Definition
(GenBank) protein kinase
Organism
mich  Micromonospora sp. HM134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NERD AAA_16 AAA_30 TrwB_AAD_bind NACHT
Motif
Other DBs
NCBI-ProteinID: QDY06846
UniProt: A0A518WC67
LinkDB All DBs
Position
1350516..1354616
Genome map
AA seq 1366 aa AA seqDB search
MVEIVDGGLPANDAERLVLKHLAEHAPDDWVILHNVEVPVRRDCYEIDLVVINGRGVCLV
DVKGTRGRIDVAGTRWHPARRAPFHSPVRKLRGHTRAVKGLLTNHQPGLSRVYVDQLVVL
PWPDARLVDPNDREDADALHVTDLGGLIPALGDVSRVRSGMLRDVRQHRNTILTALHRKV
RQPTGPKKFGDWVVCERLGGDDEVTEYRARNAMAGTSETVLLRVYRADPFLPELERATQR
HMIANAYEVLAKLPPSPFIVGRRTFFAIEDESQFVLVLDDTRGQALTVHLTDPRQALGAD
AKLRVFGDLLRGLAHAHAYGVLHRALTPAAVLVSDVNGRALLTGFDYARPEGPRDYTVAG
RLVEVLDPVYVAPECQGHAPAMSQASDVYAAGVVGFQLLTGEVPFASTAEQFQKGSELPS
AVLATAGVGTALQALLRRMCARAPSGRPSATQALRELQRLARIGAVGSEDSGPKPKPTAG
VDYGSLPAGYQLTPKYQVRDKLGSGHFGTVYRVYDNLADEDRVVKIVHKGSDSVVERLKR
EFQLLLNLPRHRCVVEVRDADYLDLGRVPYLVFEFIDGRDAKVLVAERALGPADVVRFGI
DVAEGLVHLHSEGISHCDIKPANLLRTDAGCKILDFNVATKADDSLSQVGGTPQYAPPDF
ASGPLTRADLADRDVYGLGLTLYELLTGGWPFPGKHQATGEKAADPRTYTGLGSLSDVLV
DIVLRAIAPWRSERYADAAEFLAVLRSIGDRVHRAVDVPAELAVPVPAAQADRNLFVEHL
RSLYSQSAGSNAGTRSGGTGGTGERIDLYVATALDAKLTPAVLAGRYRLVIITGNAGDGK
TAYLDRLLHAARADGPRVPVYRDNGADFQLLDGRWLRTNHDGSQDEGDRANDDVLLDFFA
PFAGAKPTGDPQETRLIAINEGRLVDFLSTHEQRFPTLAKRVRTGLAGTAENGPIAVINL
NRRSLLTEVDDLEAPVFDRLLARMTDPRRWEACRGCSLAATCYARHNAQTLANEGVGPKI
VARLRTLFSMTALRGVQHLTMRDIGSALAYLLTSGRSCEEIHQLYAGDDSAAVLDGFYFN
SWAGPAGGRDRLLSLLSQVDVAAVADPALDRRLDYVGPDAGRALMVVDQRGDYDLQLLAG
LFARLPRSAAGTAAEGDLHRRYLAAARRRFYFECVDEERSAVMLPYRSALAFMELLASPD
RVPRYLTTLIAAINRGEGLPGAAVPDGALALQVRAVPGGTIRSYRLFPASSLRLWPAGDA
ASTYLEGGYQELVLSHRGVAGHEARLRIRLDLFELLSRLGEGYLPSAAEQQGLYLGLSIF
KHELSATPYRELLLTVTGWDVHRIRIADGGVLVMDGGVTVVDGGEA
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggtggagatcgtcgacgggggtcttccggccaacgacgcggaacgcttggtgctcaag
cacctggctgagcacgccccggacgactgggtcattctgcacaacgtcgaggtcccggtg
cgtagggactgctacgagatcgacctggtcgtgatcaacggtcggggcgtctgcctggtc
gacgtcaaggggacccgggggcgtatcgatgtcgccggtacccggtggcacccggcgagg
cgagccccgttccattcgccggtacgcaagttgcgcggacacacccgggcggtcaagggc
ctgctgaccaatcatcagccggggctgtcacgggtgtatgtcgatcagttggtggtgctg
ccttggccggacgcccggctggtcgacccgaacgaccgtgaggacgccgacgcgctgcac
gtaaccgatctgggtgggctgattccggcgcttggggatgtctcccgggtccgctccggg
atgctgcgtgacgtccggcagcaccgaaacaccatcctcacggcgctgcatcgcaaggta
cgccaaccaaccggtcccaagaagtttggcgactgggtggtgtgcgagcgactcggcggc
gacgacgaggtcaccgagtatcgggcgcgaaacgcgatggctggcacgtccgagacggtt
ctcctgcgggtgtaccgcgcggacccgttcctgccggagctcgaacgcgccactcagcgg
cacatgatcgccaatgcgtacgaggtgttggcaaagttaccgccgagcccgttcatagtc
ggacggcggaccttctttgccatcgaggacgagagccagttcgtgctggttctcgacgac
acgcgcggccaggcgttgaccgtgcatctgacagatccgcggcaggcgttgggcgccgac
gcgaagctgcgcgtcttcggtgacctcctgcgcgggctggcgcacgcgcacgcctacggg
gtgctgcaccgggcgttgacgccggccgccgtactcgtctcggacgtcaacggccgggca
ctgctcaccgggttcgactacgcccgtcccgaggggccgcgggactacacggtggccggc
cgactcgtcgaggtgcttgacccggtgtacgtggcaccggagtgccaggggcacgccccg
gcgatgagccaggcatcggacgtctatgcggcaggtgttgtcggcttccagctgctgacc
ggtgaggtgccgttcgcgtcgacggccgagcagttccagaagggcagcgagctgccgtcg
gcggtgttggccaccgccggtgtcggtacggctctgcaggcgctgctgcggcggatgtgt
gcccgggcaccgtccgggcggccgtcggctacacaggcgttgcgggagctgcaacgcctc
gcccgcatcggcgccgtcggttccgaggacagtggtcctaagccgaagccgacggccggc
gtcgactacgggagcctgcctgccggctaccagttgacccccaagtaccaggtccgggac
aagctcgggtcggggcacttcggcacggtctaccgagtgtatgacaacctggccgatgag
gaccgggtcgttaagattgtccacaaaggctctgactcggtagtcgagcggctcaagcgg
gagttccaactcctgcttaacctgccacggcaccgctgtgtcgttgaggtacgcgacgct
gactatctcgatctgggccgggtgccctatctggtgttcgagttcattgacggccgcgac
gcgaaggtgctggtagccgagcgggcattggggccggccgacgtcgtgcggttcggtatc
gacgtggccgagggactcgttcacttgcatagtgaggggatttcgcactgcgacatcaag
cccgcgaacctgctgcggacggatgctggctgcaagatcctggacttcaatgtggcgacc
aaggccgacgacagcctgtcccaggtgggtggaactccgcagtacgccccgcccgacttc
gccagcggcccgcttacccgggcggatctggccgaccgggacgtgtatgggcttgggctg
acgctctacgagttgcttactggggggtggccctttccaggcaagcatcaggccacaggc
gagaaggcggccgatccgcggacatacaccggtctgggaagcctgtccgatgtgctggtg
gatatcgtgctgcgggccatcgcgccatggcgcagcgagcggtatgccgacgcggccgag
ttcctggctgtcctgcggtcgatcggtgaccgggtacaccgagcggtggatgtcccagcg
gagttggcggtgccggtcccggcagcgcaggccgatcggaacctgttcgtcgagcacctg
cggtcgctctacagccagagtgccggcagcaacgctggtacccgcagcggtggcacgggc
ggtaccggcgagcggatcgacctctatgtggcgacagcgctcgacgcgaagctgacgccg
gcggtcctcgccgggcggtaccggttggtcatcatcacgggcaatgctggcgacgggaag
acggcctacctggaccggctgctgcacgccgctcgcgccgacggaccgcgcgtgccggtg
taccgcgacaatggcgcggacttccagttgctggatggacgctggctgcgaaccaaccac
gacggcagccaggacgagggggaccgggctaacgacgacgtcctgctggacttcttcgcc
ccattcgccggggccaaaccgaccggtgacccgcaggagaccagactcatcgcgatcaac
gaaggccggctggtcgacttcttgagcacccacgagcagcgtttcccgacgctcgccaag
cgggtccgtaccgggctggccggcaccgccgagaatggcccgatcgcggtgatcaacctc
aaccggcgaagcttgctgacagaggtggacgacctcgaagcaccggtcttcgaccgccta
ctggcgcggatgaccgatcctcgccgctgggaggcatgtaggggatgctcgctcgcggcg
acctgttatgcccgacataacgcccagaccctcgccaacgagggggtcggcccgaagatc
gtggcgcggctacggacgttgttctccatgacagcgctacggggcgtgcagcacctgacc
atgcgggacatcggctcggcactggcctacctgctcaccagcgggcgcagctgcgaagag
atccaccagttgtatgccggcgacgacagcgctgcggtcctcgacgggttctatttcaac
agctgggccgggccggcgggcggccgtgaccgactgctgtccctactgtcacaggtggac
gtcgcggccgtggctgacccggcactcgaccgacggctggactacgtcggccccgacgcc
ggccgggcactcatggtcgtcgaccagcgtggcgactacgacctgcagctgctcgccggg
ttattcgcgcggctgccccggagcgctgccggcactgcagccgagggcgacctgcaccgc
cgctacctggctgcggcccgtcgcagattctacttcgaatgcgttgacgaggagcgctcg
gccgtgatgctgccctaccggtcggctctggcgttcatggagctgctcgcatcccccgac
cgggtaccccgatacctgaccacgctcatcgctgcgatcaaccgcggggaagggctgccc
ggggcggcggtccccgatggagcgctggcgctgcaggtgagggcagtgccaggcggcaca
atccgcagctaccggctgtttcctgccagtagcctccgtctttggcccgctggcgacgcc
gcctcgacgtacttggagggcgggtaccaggagttggtgctcagccaccgaggagtcgcc
ggtcacgaggcgcggctgcggatccggctggacctattcgagctgctgtcgcggctcggc
gaaggatacctgcccagcgccgccgagcagcagggcctgtacctaggattgagcatcttc
aagcacgagctgtcggcaacgccataccgggaattgctgctcaccgtgacgggctgggac
gtgcaccggatccgcatcgccgacggcggcgtgctcgtgatggacggcggcgtgacggtc
gtggatggcggggaggcatga

DBGET integrated database retrieval system