KEGG   Micromonospora sp. HM134: FJK98_10475Help
Entry
FJK98_10475       CDS       T06145                                 

Definition
(GenBank) glycoside hydrolase family 3 protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mich  Micromonospora sp. HM134
Pathway
mich00520  Amino sugar and nucleotide sugar metabolism
mich01100  Metabolic pathways
mich01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mich00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FJK98_10475
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FJK98_10475
Enzymes [BR:mich01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FJK98_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: QDY07544
UniProt: A0A518WE59
LinkDB All DBs
Position
2343978..2345465
Genome map
AA seq 495 aa AA seqDB search
MNERNLAGLAATVLQPGFVGTTPPDWVCRWLAEGLGAVVLFARNVVDPEQVAALTATLRA
ERPDVLVAIDEEAGDVTRIESGRGSSRPGNLALGAVDDPTLTEDVARDLGVELADLGVTL
NYAPDADVNINPANPVIGVRSFGADPHLVARHTAAWVRGLQSAGVAACAKHFPGHGDTRV
DSHHDLPRIGASRARLDAGELVPFRAAVAAGVQAVMTGHLLVPALDPDLPATLSRRILGD
LLREELGFSGVVVTDAVEMRAVADRYGFAGTAVRALAAGADAICVGGERADEAAARYLRD
AIVAAVLAGELPEERLAEAAKRVGQLAEWSAAARAGRPDPAPRPADGSPVGLTAARRAVR
VSGDAVSRLPLTAAAHVVEFAAPHNIAIGAETPWGLGAPLADLLPGTTTVRLAEADLPAD
PTAGAAGRPLVLVVRDLHRHPWMRAAVDRALATRPDAVIVELGLPELVTGGLHLATHGAT
RAAARAAAELLTGTR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcgcaacctggcgggtctggccgccaccgtcctgcaacccggcttcgtcggc
accaccccgcccgactgggtctgccggtggctggccgaggggctcggcgcggtggtgctg
ttcgcccgcaacgtcgtcgacccggaacaggtggccgcgctcaccgcgacgctgcgcgcc
gaacgccccgacgtgctggtggccatcgacgaggaggccggcgacgtcacccggatcgag
tccggccggggcagctcccgccccggcaacctcgccctcggcgcggtcgacgacccgacg
ctcaccgaggacgtggcccgcgacctcggcgtcgaactcgccgacctcggcgtcaccctc
aactacgccccggacgccgacgtcaacatcaacccggccaacccggtgatcggggtgcgt
tccttcggcgccgacccgcacctggtggcccggcacaccgccgcctgggtacgcggcctc
cagtccgccggcgtcgccgcctgcgccaagcacttccccggccacggcgacacccgggtc
gactcgcaccacgacctgccccgcatcggggccagccgggcccgcctggacgccggtgag
ctggtccccttccgggccgccgtcgccgccggggtgcaggcggtgatgaccgggcacctg
ctggtccccgccctcgaccccgacctgccggccaccctcagccgccgcatcctcggcgac
ctgctccgcgaggaactgggcttctccggcgtggtggtcaccgacgcggtggagatgcgc
gccgtcgccgaccggtacggcttcgccggcaccgccgtccgggccctcgccgccggagcg
gacgcgatctgcgtcggcggtgaacgcgccgacgaggccgccgcccgctacctgcgcgac
gcgatcgtggccgcggtgctcgccggtgagctgcccgaggaacgcctcgccgaggccgcc
aagcgggtcggtcagctcgccgagtggagcgccgccgcccgcgccggccggcccgacccc
gccccgcgccccgccgacggctcgccggtcggcctgaccgccgcccggcgcgcggtacgg
gtcagcggcgacgcggtcagccggctgccgttgaccgccgccgcgcacgtggtcgagttc
gccgcgccgcacaacatcgcgatcggcgcggagaccccgtgggggctcggggcccccctg
gccgacctgctccccggcaccaccaccgtccggctcgccgaggccgacctgcccgccgac
ccgaccgccggggcggccggccggccactggtgctggtggtgcgggacctgcaccggcac
ccgtggatgcgggccgcggtcgaccgggcgctggccacccgcccggacgccgtgatagtc
gaactcggcctgcccgagctggtcaccggcgggctgcacctggccacccacggcgcgacc
cgggccgccgcccgcgccgccgccgaactgctcaccggaacccgctga

DBGET integrated database retrieval system