KEGG   Micromonospora sp. HM134: FJK98_13400Help
Entry
FJK98_13400       CDS       T06145                                 

Definition
(GenBank) zinc-binding dehydrogenase
Organism
mich  Micromonospora sp. HM134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AdoHcyase_NAD AlaDh_PNT_C Pyr_redox NAD_binding_8 HI0933_like FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: QDY08033
UniProt: A0A518WFL9
LinkDB All DBs
Position
complement(3056921..3057946)
Genome map
AA seq 341 aa AA seqDB search
MNHSAHYVGDHTFVVERTAVVPPGPGQVRIDVAYTGICGTDLHVAHGAMDQRVRVPAVIG
HEMSGRIAEVGPGVQGHRVGDPVTVMPLDWCGDCPACRAGNSHICHRLTFIGIDSPGAMQ
RSWTVPARIVVPLPADLPLTHAALIEPTAVAVHDVRRSRLTAGEHAVVVGAGPVGLLIGT
VARATGAEVTVLELDPRRRALATELGLRTVDPATVDVARHVHETTGGAGAAVAFEVSGSA
AGVRTATDLLAARGRLVVVAIHPTPREVDLHRVFWRELELIGVRVYEREDYTEAVRLVHG
GQVPAGRLITRVVPLPEVAEAFRALAAGGEVKILVDCGATG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccacagcgcgcactacgtcggcgaccacaccttcgtcgtcgagcggaccgccgtc
gtaccgcccggccccggccaggtgcgcatcgacgtcgcgtacaccgggatctgcggcacc
gacctgcacgtggcgcacggcgcgatggaccagcgggtccgggtgccggcggtgatcggc
cacgagatgtccggacgcatcgccgaggtcggccccggggtgcaggggcaccgggtgggc
gacccggtgaccgtgatgccgctggactggtgcggcgactgccccgcctgccgggccggc
aacagccacatctgccaccggctcaccttcatcggcatcgactcccccggcgcgatgcag
cgctcgtggacggtgcccgcgcggatcgtggtgccgctgcccgcggacctgccgctgacc
cacgccgcgctgatcgagccgaccgccgtcgccgtgcacgacgtacgccggtcccggctg
accgccggggaacacgcggtggtcgtcggcgccgggccggtcggcctgctcatcgggacg
gtcgcccgggccaccggggccgaggtgacggtgctcgaactcgacccgcgccgccgggcc
ctcgccaccgaactcgggctacgcaccgtcgacccggcgacggtggacgtcgcccggcac
gtgcacgagacgaccggcggggccggggcggccgtggcgttcgaggtgtccgggtccgcc
gccggggtccgcaccgcgaccgacctgctcgccgcacgcggccggctggtcgtcgtggcg
atccaccccaccccccgggaggtggacctgcaccgcgtcttctggcgggaactggagctg
atcggggtgcgggtgtacgaacgggaggactacaccgaggccgtccggctggtgcacggc
ggacaggtgcccgccgggcggctgatcacccgggtcgtgccgttgcccgaggtggccgag
gcgttccgggcgctcgccgccggcggcgaggtgaagatcctcgtcgactgcggcgccacc
gggtga

DBGET integrated database retrieval system