KEGG   Micromonospora sp. HM134: FJK98_25610
Entry
FJK98_25610       CDS       T06145                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
mich  Micromonospora sp. HM134
Pathway
mich00900  Terpenoid backbone biosynthesis
mich01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mich00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FJK98_25610
Enzymes [BR:mich01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     FJK98_25610
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: QDY10115
UniProt: A0A518WLJ3
LinkDB
Position
complement(5933864..5934676)
AA seq 270 aa
MIRSLRAGRREPVPPTPHPSGARPPALPAEALPKHVAVVMDGNGRWAKERGLPRTKGHEQ
GEYSLFDTVEGAIELGVPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVDLGV
RVVWSGRAGRLWKSVIAELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAAIAREVAAG
RLDPDRITEKTVAKYLYHPEVPEVDLFLRPSGEERISNFMLWQSAYAELVFLDTLWPDFD
RRHLWYACELYAQRDRRFGGALPNPVAPPR
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgatccgatcgttgagggccggccggcgggagccggtgccgccgaccccgcacccgtcg
ggggcgcgtccaccggcgttgcccgccgaggcgctgccgaagcacgtcgcggtggtgatg
gacggcaacggccgctgggccaaggagcgcggcctgccccgcaccaagggccacgagcag
ggcgagtacagcctcttcgacaccgtcgagggggcgatcgagctgggggtgccctacctg
tcggcgtacgccttctccaccgagaactggcggcgctcgccggacgaggtccgtttcctg
atgggcttcaaccgggacgtcatccgtcgccgccgcgaccagctcgtcgacctgggcgtc
cgggtggtgtggtcggggcgggcgggccggctgtggaagagcgtcatcgccgagttgcag
accgcggaggagatgtcccggggcaactcgacgctgaccctccagttctgcgtcaactac
ggcggtcaggccgagatcgccgacgccgccgccgcgatcgcccgggaggtggccgccggt
cggctcgacccggacaggatcaccgagaagaccgtggcgaagtacctctaccacccggag
gtccccgaggtggacctgttcctgcgcccctccggcgaggaacggatctcgaacttcatg
ctctggcagtcggcgtacgcggagctggtgttcctggacaccctctggccggacttcgac
cgtcgccacctgtggtacgcctgcgagctgtacgcccagcgggaccgccgcttcggcggc
gcgctgcccaacccggtcgccccgccgcgctga

DBGET integrated database retrieval system