KEGG   Microbacterium sp. 1.5R: BMW26_01515Help
Entry
BMW26_01515       CDS       T04912                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00473  D-Alanine metabolism
micr00550  Peptidoglycan biosynthesis
micr01100  Metabolic pathways
micr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMW26_01515
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMW26_01515
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BMW26_01515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:micr01011]
    BMW26_01515
Enzymes [BR:micr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMW26_01515
Peptidoglycan biosynthesis and degradation proteins [BR:micr01011]
 Precursor biosynthesis
  Amino acid ligase
   BMW26_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK PepSY_2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APH43779
LinkDB All DBs
Position
306311..307306
Genome map
AA seq 331 aa AA seqDB search
MRVLVIGGGQNAEHEVSLASAAAVAEALRLGGYDVSTVTISRQGVWEVAGVSEGATAAGS
LALAMPLLADCDVVFPAVHGPLGEDGALAALCGLAGVRVVGSGPRAGAIGMDKWATKLVA
EAAGLRTARGRVVDAADCGDAEFEGPVVVKPVSAGSSYGVSLVRGEHELGPALREAARFD
RRILIEEVVQGREIDVAVLREAGGVRWAAPPLEIHAAGLFDTATKYDGSARFTVPAQLST
AESTSLTRAALTMFDALGCAGVARMDFFLTAEGPVLNEVNTMPGLTAASQAPRMFAAADV
SYVDLVSRLVRAAEVPGGDGARRRAGLERVA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgctggtgatcgggggagggcagaacgccgagcacgaggtgtcgctcgcctcg
gcggcagcggtcgcagaggccctgcggctcgggggatacgacgtgagcacggtgacgatc
tcgcggcagggcgtgtgggaggtggcgggcgtctcggagggtgccaccgccgccggatcc
ctcgctctcgcgatgccgctcctcgccgactgcgacgtcgtattccccgccgtgcatgga
cccctgggagaggacggagcactcgcggcactgtgcggtctcgcaggggtgcgcgtggtc
ggatcgggtccgcgggccggcgccatcggcatggacaagtgggccaccaagctcgtcgcc
gaagcggcagggctgcgcacggcacggggacgcgtcgtcgatgcggcggactgcggcgat
gccgagttcgaggggcccgtggtggtgaagccggtgtcggccggttcgagctacggtgtc
tcgctcgtgcggggagagcatgaactggggccggcgctccgcgaggcggcgcggttcgac
cgccgcatcctcatcgaagaggtcgtgcaggggagggagatcgatgtcgccgtcctgcgc
gaagccggtggcgtccgctgggcggcgccgccgctcgagatccacgccgccggcctcttc
gacaccgccacgaagtacgacggcagcgcgcgattcaccgtgcccgcgcagctgtcgacg
gccgagtcgacctcgctcacgcgtgcggcgctgaccatgttcgacgccctcggatgcgcc
ggggtcgccaggatggacttcttcctcaccgccgagggcccggtgctgaacgaggtcaac
acgatgccggggctcaccgcggcctcgcaggcgccgcgcatgttcgcggcggccgatgtg
tcgtacgtcgacctcgtgtcgcgcctcgtgcgagccgctgaggtgccaggcggtgacggt
gcgcgccggagggccggcctcgagcgggtcgcctag

DBGET integrated database retrieval system