KEGG   Microbacterium sp. 1.5R: BMW26_01605Help
Entry
BMW26_01605       CDS       T04912                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BMW26_01605
Enzymes [BR:micr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BMW26_01605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 Glyco_hydro_2_C DUF4434 DUF4350
Motif
Other DBs
NCBI-ProteinID: APH43796
LinkDB All DBs
Position
326560..328566
Genome map
AA seq 668 aa AA seqDB search
MTSPHAWPDLRGIAYGGDYNPEQWSPETWREDVILMREAGVNLVSVGIFSWALIEVSEGE
FDFAWLDELLDLLHENDIRVDLGTPTASPPAWFFASNPDAHVIDREGRTMGFGSRGMASH
SSPAYREAIVRIADALAVRYAQHPSVVLWHVHNEYGVPVGEDYSQNAVAAFRLWLQEKYG
SLDALNSAWGTAFWGQHYSAWEHVGAPAIAPSVVNPAQRLDFARFTDHQLRACFIAERDA
IRAHAAQPITTNFMANQSWTTDLWAWGREVDIVSDDHYLWAADEDAHIGLAIAADLSRSV
GGGKPWILMEHSTSAVNWQPRNIAKRRGEMKRNSLTHLGRGADGILFFQWRAGRSGAEKF
HSAMLPHAGTESRVFREVVDLGAALGRLDEVQGSVVKADVAILWDFESFWAQDLEWRPSE
DVTHAAQVRRFYEQLWRDGITVDFALPGQDLSGYRLVVAPAQYLLSTADAANLTAYVNDG
GTLLVSFFSAIVDENDAVHAGGFVAPLREALGLTVEEFLPLREGESHGLDWVDHEGIVAD
VWQEDIALEGAEVVANFSGGPGEGEPAITRNAHGAGTGWYVGTRLDAAGMRALLHEVYAD
ADITPSGVADGLEVITRHGADAVYRIAVNHRDDDVELDASGIELLSGAEVSGALTIAAGG
VAVIRTSH
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgccccacgcctggcccgacctgcgcggaatcgcctacggcggcgactacaac
cccgagcagtggtcgcccgagacgtggcgcgaagacgtcatcctgatgcgcgaggccggg
gtgaacctggtcagtgtcggcatcttctcgtgggcgctcatcgaggtctccgagggcgag
ttcgacttcgcctggctcgacgagctgctcgacctcctgcacgagaacgacatcagggtc
gacctcggcaccccgacggcctcgccgcccgcctggttcttcgcgagcaaccccgacgcg
cacgtcatcgaccgcgagggccgcacgatgggcttcggctcgcgcggcatggcctcgcac
tcgtcgccggcctaccgcgaggcgatcgtgcggatcgcggatgctctcgcggtgcgttac
gcacagcatccttccgtcgtgctgtggcacgtgcacaacgagtacggcgttcccgtcggc
gaggactattcgcagaacgcggtcgccgccttccggctctggctccaggagaagtacggc
tcgctcgacgcactgaacagcgcgtggggcaccgccttctggggccagcactactcggca
tgggagcacgtcggcgccccggccatcgccccgagcgtcgtgaaccccgcccagcgcctg
gacttcgcgcgcttcaccgatcaccagctgcgcgcgtgcttcatcgccgagcgcgacgcg
atccgcgcgcacgccgcccagcccatcacgaccaacttcatggcgaaccagagctggacc
acggacctctgggcgtggggccgcgaggtcgacatcgtctcggacgaccactacctgtgg
gccgccgatgaagacgctcacatcggcctggcgatcgccgccgacctcagccgctcggtg
ggcggcggcaagccgtggatcctcatggagcactcgacctcggccgtgaactggcagccg
cgcaacatcgcgaagcgccggggagagatgaagcgcaactcgctcacgcacctcggtcgc
ggggccgacggcatcctgttcttccagtggcgcgccgggcgctccggtgcggagaagttc
cactcggcgatgctgccgcacgccggcaccgagtcgcgggtcttccgcgaggtcgtcgat
ctgggtgcagcactcggccgcctcgacgaggtgcagggcagcgtcgtgaaggccgacgtc
gcgatcctctgggacttcgaatcgttctgggcgcaggacctcgagtggcgcccgtccgaa
gacgtcacgcacgccgcccaggtgcgccgcttctacgagcagctctggcgtgacggcatc
acggtcgacttcgccctgcccggccaggacctctcgggctaccgcctggtcgtcgctccg
gcgcagtatctgctgagcacggcggatgccgccaacctcaccgcctacgtcaacgacggc
ggcaccctgctcgtgtcgttcttctcggcgatcgtcgacgagaacgacgccgtgcacgcc
ggtggcttcgtcgcgccgttgcgcgaggcgctcggcctcacggtcgaggagttcctgccg
ctgcgcgagggcgagagccacggcctcgactgggtcgaccacgagggcatcgtcgccgac
gtctggcaggaggacatcgcgctcgaaggcgccgaggtcgtcgcgaacttctcgggcgga
cccggcgagggcgagccggcgatcacccgcaacgcgcatggcgccgggaccggctggtac
gtcggcacccgtctggatgccgcgggcatgcgcgcccttctccacgaggtctacgcggat
gccgacatcaccccgtcgggtgtcgccgacggcctcgaggtcatcacgcgtcacggcgcc
gacgcggtctaccggatcgccgtgaaccaccgtgacgacgacgtcgagctcgatgcctcg
ggcatcgagctcctcagcggcgccgaggtctcgggcgccctgaccatcgcggcgggcggc
gtcgccgtcatccgcacctcccactga

DBGET integrated database retrieval system