KEGG   Microbacterium sp. 1.5R: BMW26_04490Help
Entry
BMW26_04490       CDS       T04912                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMW26_04490
Enzymes [BR:micr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BMW26_04490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APH44308
LinkDB All DBs
Position
955890..957338
Genome map
AA seq 482 aa AA seqDB search
MTVIALRHFIDGTWVEGGGEALVDVNPSRPSDIVAEGPGASDADVDRAYAAARAAFDGWR
RTPARARAGILLRAADIIEAHRDEWGRELAREEGKTLAEAIAETGHSANILRFHAQEVER
QSGGVFESPTPGERILVIRRPVGVVGAITPFNFPISIPAWKLAPALVWGNTVVWKPATFV
PVLAMRFAEALEQAGLPRGVLNLVNGTAAVGEAIVSHPDVDAVTFTGSTKVGRIIAAQLA
ARGVPFQGELGGKNASLVLADADLDVAVEQVAIGAFRAAGQKCTATSRVIVHHAVADEFL
RRLAARTERMVVGDAEDEAVEVGPVVDGSARDRVAAAIARARTTATAVVAPQPYAAGDLD
DGYFIAPSVFELNEDDPGELWTEELFGPVIGVRRVSSTEAGIALVNDSDYGLSTAVFTTG
LADALSAIEDIRAGVVHINSASAGADLHVPFGGSGASALGPKEQGAAAREFFTETATVYL
KG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcgccctgcgccacttcatcgacgggacctgggtcgagggtgggggagag
gcactcgtcgacgtcaatccgagccgaccgagcgacatcgtcgccgaggggccgggagcg
tcggatgccgatgttgaccgcgcctatgccgcggcccgtgcggcattcgacggttggcgt
cgcacaccggcacgcgcacgcgccggcatccttctccgtgcagccgacatcatcgaggcg
catcgtgacgagtggggtcgggagctcgcccgcgaagagggcaagacgctcgcagaggcg
atcgccgagaccgggcattcagcgaacatcctccgtttccacgcccaagaggtcgaacgc
cagagcggcggtgtcttcgagtcgccgactccgggggagcgcatcctcgtgatcagaaga
cctgtgggcgtcgtcggggcgatcacgccgttcaacttcccgatctcgatcccggcgtgg
aagctcgctcctgccctggtctggggcaacacggtggtctggaaacccgcgacgttcgtg
ccggtgctcgcgatgcggttcgccgaggcgctcgagcaggctggactgccccggggtgtg
ctgaacctcgtgaacggcacggccgccgtcggcgaagcgatcgtctcgcatccggatgtg
gacgcggtgaccttcaccggctccacgaaggtaggcaggatcatcgcagcgcagctggct
gcccgcggagtcccgttccagggcgagttgggcggcaagaacgcctctctcgtgctcgcc
gacgcagacctcgacgtcgctgtggagcaggtggcgatcggggcttttcgcgcagcagga
cagaagtgcaccgcgacctcacgggtgatcgtgcaccacgcggtcgccgacgagttcctg
cgtcggctcgccgcacggaccgagcggatggtcgtgggcgacgccgaagacgaggccgtc
gaggtcgggccagtcgtggatggctccgcgcgagaccgcgtcgcggccgccatcgcgcgc
gcgcgaacgactgcgacagcagtggtcgctccgcaaccgtacgcggccggcgacctcgac
gacggctatttcatcgcaccgtcggtgttcgagctgaatgaggacgacccgggcgagctg
tggacggaggagctgttcggccccgtgataggcgtgcgcagggtatcgagcaccgaagcg
gggatcgcgctcgtcaacgacagcgactacggcctctcgaccgcggtcttcacgaccggt
ctcgcggatgcgctcagcgcgatcgaggacatcagggcgggtgtcgtgcacatcaactcg
gcgtcggccggcgcagacctgcacgtgccgttcggcggcagcggcgcgagtgcgctcggg
ccgaaggagcagggcgccgcggcccgggagttcttcaccgagaccgcgacggtgtatctg
aagggttga

DBGET integrated database retrieval system