KEGG   Microbacterium sp. 1.5R: BMW26_05165Help
Entry
BMW26_05165       CDS       T04912                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00620  Pyruvate metabolism
micr00680  Methane metabolism
micr01100  Metabolic pathways
micr01120  Microbial metabolism in diverse environments
micr01200  Carbon metabolism
Module
micr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMW26_05165
  09102 Energy metabolism
   00680 Methane metabolism
    BMW26_05165
Enzymes [BR:micr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BMW26_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APH46613
LinkDB All DBs
Position
complement(1110657..1113344)
Genome map
AA seq 895 aa AA seqDB search
MTPEHAFPEPTDTSAIRIIGRFEAGRGIPDAMRTDVRMLGALLGQVLREAGGDDLFEDVE
RLRLATIQAYDEETSDAFDRAAAIAESFSIARADEVARAFTCYFHLVNLAEEHQRVRVLR
ERAGQPGREDAADTVATAYARLKTEVGDDEALRRLEGLRFHPVFTAHPTEARRRAVSSSI
RRLSELLTQHDAASEGGSEEHRARRRMLEEIDTLWRTAPLRAEKPSPTDEVRTVVGVFDE
TLFTTVPHVYRRIDDALRGDDSGSSAPVVPAFVRIGSWVGGDRDGNPFVTASVTREASQI
ASDHVLRGLERALERIGRALTLDAEDTPASAGVTALWEAFAAAEPRVAEELGARSPGEPH
RRVLLALAHRVAATRRGEEQRYSRPEELLDDLRTVQSSLADAGAKRHAFGGVQHLIWQVE
TYGFHLTELEVRQHSQVHRKALSELSSGDAISAQTEEVLEVFRVIAEIQRDRGLRAAGRY
VVSFTQSASDLANVYALARHALGDDAPVLDVVPLFETFADLQAAPAILAEAVTFPEFQER
LAATGNRLEVMLGYSDSSKDVGPVAANLALYEAQEKIAQWAKDSDIELTLFHGRGGALGR
GGGPANSAILAQPPHSVDGRFKLTEQGEVIFARYGEPAIAMRHIDQVAAATLLASSPSVE
KHTSDAAARFADIAAVMDTSSRERFFSLVKAEGFAPWFATVTPLEEIGLLALGSRPARRG
LSVESLEDLRAIPWVFAWTQARINLAGWFGLGTALAAVGDEARLAEAYRDWPLLRTMIDN
VAMSLAKTDERIARQYLALGDRDDLAQLVLDELSLTREWVIRLTGGVGLLENKPILQRAV
QLRTPYVDALSLLQLRALRALRDPAEATGSGADDEQRRLLLLSVSGVAAGLQNTG
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccgaacacgccttccccgagcccactgacacctcggccatccgcatcatcggc
cgtttcgaagcgggccgcggcattccggatgccatgcgcaccgatgtcagaatgctcggc
gcccttctcggccaggtactgcgcgaagcaggcggtgacgacctcttcgaggacgtcgag
cggctgcggctggcgacgatccaggcctatgacgaagagacctccgacgccttcgatcgg
gcggccgcgatcgccgagtcgttcagcatcgcgcgcgccgacgaggtcgcccgggcgttc
acctgctacttccacctcgtcaatctcgccgaggagcaccagcgcgtgcgggtgctccgc
gagcgggccggccagccgggccgcgaggatgcggccgacaccgtcgccaccgcctatgcg
cgtctgaagacggaggtcggtgacgacgaggcgctccgccgtctcgagggcctgcgcttc
cacccggtgttcaccgcccacccgaccgaggcacgccgtcgcgcggtgtcgtcgagcatc
cgccgcctctccgagctgctcacccagcacgacgccgcgagcgagggcgggtcggaggag
caccgcgcgcgccggaggatgctggaggagatcgacaccctctggcgcaccgcgccgctc
cgcgccgagaagccctcgccgaccgacgaggtgcgcacggtcgtgggcgtgttcgacgag
accctgttcaccaccgtgccgcacgtgtaccggcgcatcgacgacgcactccgcggcgac
gactccggctcgagcgctccggtcgtgcccgcgttcgtgcgcatcgggtcctgggtcggc
ggcgaccgcgacggcaacccgttcgtgaccgcatccgtcacccgtgaggcgtcgcagatc
gcgtccgaccacgtgctgcgcggactggagcgcgcactcgagcgcatcggccgcgccctc
acgctcgacgccgaggacacccctgcgagcgcaggagtcacggctctgtgggaggccttc
gccgccgctgagccgcgcgtcgccgaggagctgggcgcccgctcccccggtgagccgcac
cgccgcgtgctgctcgccctcgcccaccgtgtcgcggccacccgccgcggcgaggagcag
cgctactcgcgccccgaggagctgctcgacgacctgcgcacggtgcagtcgtcgctggcg
gatgcgggcgcgaagcgccatgcgttcggcggcgtgcagcacctcatctggcaggtggag
acctacggcttccatctgaccgagctcgaggtgcgtcagcactcgcaggtgcaccgcaag
gcgctctcggagctctccagcggcgacgcgatcagcgcgcagaccgaggaggtgctcgag
gtcttccgcgtgatcgccgagatccagcgcgaccgcggcctgcgggctgccggccgctat
gtcgtgtcgttcactcagtcggcgtccgacctcgcgaacgtgtatgcgctcgcgaggcac
gcgctgggcgacgacgcccccgtgctcgacgtcgttcccctgttcgagaccttcgccgac
ctgcaggcggcgcccgccatcctcgcggaggccgtgacgttcccggagttccaggaacgc
ctcgccgcgacgggcaaccggctcgaggtcatgctcggctactccgactcgtcgaaggac
gtcggcccggtcgccgcgaacctcgccctgtacgaggcgcaggagaagatcgcgcagtgg
gccaaagactccgacatcgaattgaccctgttccatggtcgcggcggtgctctgggccga
ggcggcggacccgccaactcggccatcctcgctcagccaccgcactcggtcgacggtcgc
ttcaagctcaccgagcagggcgaggtcatcttcgcgcgctacggcgagccggccatcgcg
atgcgccacatcgatcaggtcgccgcggcgacgctgctcgcctcgtcgccgtccgtcgag
aagcacacgagcgacgccgccgcacgcttcgccgacatcgccgccgtcatggacacctcg
tcgcgcgagcgcttcttctcgctcgtcaaggcggagggcttcgccccctggttcgccacg
gtcacccctctcgaggagatcggcctgctcgccctgggctcccgcccggctcgacgcggg
ctgtcggtcgagtcgctggaagacctgcgcgcgatcccgtgggtcttcgcctggacccag
gcccgcatcaacctcgccggctggttcggactcggaaccgctctcgccgccgtcggcgac
gaggcccgtctcgccgaggcctatcgcgactggccgctgctgcgcaccatgatcgacaac
gtcgccatgagcctcgcgaagaccgatgagcgcatcgcccgccagtacctcgccctcggc
gatcgggacgatctcgcgcagctcgtgctcgacgagctgtcgctgacgcgcgagtgggtc
atccgtctcaccggcggcgtgggcctgctcgagaacaagccgatcctgcagcgcgccgtg
cagctgcgcactccgtacgtcgacgccctgtcgctgctgcagctgcgcgccctccgcgca
ctgcgcgacccggccgaggcgaccggctcgggtgccgacgacgagcagcggcgactgctg
ctgctctcggtgagcggcgtcgcggcgggcctccagaacaccgggtga

DBGET integrated database retrieval system