KEGG   Microbacterium sp. 1.5R: BMW26_11320Help
Entry
BMW26_11320       CDS       T04912                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:micr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BMW26_11320
Enzymes [BR:micr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BMW26_11320
DNA repair and recombination proteins [BR:micr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BMW26_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: APH45476
LinkDB All DBs
Position
2364341..2366317
Genome map
AA seq 658 aa AA seqDB search
MVAEAQNVQIDGRRLRITNLDKVVYPETGTTKGEIIAYYTAIAPHLLPLLAGRPVTRKRW
VEGVGTADAPADAFFTKQLEPGAPEWIPRQPIRHSDGPKEYPLVQDVPTLVWLAQVAAIE
LHVPQWRFASDGMPGKPDRLVLDLDPGPGVGLAQCAEVARIARSLLSDIGLDPVPVTSGS
KGIHLYAALPGQQTSAEISAVVKEIARLIETEHPDLATSTMAKAARGGKVFLDWSQNNGK
KTTISPYSMRGRAHPWVAAPRTWDELDDPDLAQLDFATVLERAGSGQDPIAPLLAAQEGP
PDTTSAPGPRVDAHGANSHASRHRPRTTGAAPLASSSPPSVSPMLAENGTPAIARTLSSP
SWVEVKWDGIRAIGTWADGRMLLHARSGTDITARYPELTADGAPFLPVSDAIIDGEIVAF
DAQGRPSFSMLQNRMHLTRPREIEREVVRTPIVYMAFDLLRLNGHDLSTMALSERRTLLE
EVVADLDAPVQVPPVFDDLDAALAASDEFGLEGVVVKDPSSRYRPGQRSPAWLKIKHTRM
QEVVIVGIRPGKGDREGTFGSLLLAVPESGRLRYVGRVGTGFTDRMLRDLLSRLAPLRTD
SAPLEDVPALDASDALWVRPELVGEVEFANWTPDGVLRHSRWRGLRPDKTPDEVIVES
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagaggcgcagaacgtgcagatcgatggccgccggctgcgcatcaccaacctc
gacaaggtcgtctaccccgagaccggcaccacgaagggcgagatcatcgcctactacacg
gcgatcgcgccgcacctcctccctctgctcgcgggccgccccgtgacccgcaagcgctgg
gtggaaggggtggggaccgcggatgctcccgccgacgcgttcttcacgaagcagctcgag
ccgggagctccggaatggatcccccgacagccgatccggcactcggacggccccaaggag
tatcccctcgtccaggacgttcccacgctggtctggctcgcgcaggtcgccgcgatcgag
ctgcacgtgccgcagtggcgcttcgcctccgacggcatgccgggaaagccggatcggctc
gtcctggatctcgacccgggcccgggggtcgggctcgcccagtgcgccgaggtcgcacgg
atcgcacgcagcctgctcagcgacatcggactcgatccggtgcccgtgaccagcggaagc
aaagggatccacctctacgccgccctccccgggcagcagacgagcgcagagatatccgcg
gtcgtgaaggagatcgcccgtctgatcgagaccgagcatccggatctcgccacgagcacg
atggccaaggccgcgcgcggcggcaaggtctttctcgactggagccagaacaacggcaag
aagacgacgatctcgccgtactcgatgcgtggtcgcgcgcacccctgggtggcggctccg
cgcacctgggacgaactcgacgaccccgacctcgcgcagctcgacttcgcgacggtgctc
gagcgtgcgggttccgggcaggaccccatcgctccgcttctcgccgcccaggagggcccc
ccggacaccacctctgcgccgggcccccgcgtcgacgcacacggcgcgaactcgcatgcg
agccgccaccgcccgcggacgaccggtgcggcaccactggcctcgtcgtctcccccctcc
gtctcccccatgctggccgagaacggcacgccggcgatcgcccgcactctgagctctccg
tcgtgggtggaggtgaagtgggacggcatcagggccatcggaacctgggcggacggacgg
atgctgctgcatgcccgcagcggcaccgacatcacggcccgctaccccgagctgactgcc
gacggcgcgccgttcctgcccgtgtccgatgcgatcatcgatggcgagatcgtcgccttc
gatgcgcagggcaggccgagcttctcgatgctgcagaaccgcatgcacctgacccggccc
cgcgagatcgaacgcgaggtcgtgcgcacgcccatcgtctacatggctttcgatctgctc
cgactgaacggtcacgacctcagcaccatggcgctgtcggagcgacggaccctcctcgag
gaggtcgtcgccgacctcgatgcgccggtgcaggtcccgcccgtgttcgacgatctcgac
gccgctctcgcggcgagcgacgagttcggcctcgagggcgtcgtcgtcaaggatccgtcc
tcgcggtaccgtccgggccagcgctcaccggcctggctgaagatcaagcacacccgcatg
caggaggtcgtgatcgtcggtatccgccccggcaagggcgaccgggagggcacgttcggc
tccctgctgctcgcggtccccgagtccggacggctgcgctatgtcggtcgcgtcggcacg
ggattcaccgaccggatgctgcgcgacctgctgagccggctcgctcccctgcgcaccgac
tccgcgcccctcgaggacgtgcccgcgctcgatgcgtcggatgcgctctgggtccgacct
gagctcgtcggcgaggtcgagttcgcgaactggaccccggacggcgttctgcgtcactcc
cgttggcggggactccggccggataagactcccgacgaggtgatcgtcgagtcctga

DBGET integrated database retrieval system