KEGG   Microbacterium sp. 1.5R: BMW26_12895Help
Entry
BMW26_12895       CDS       T04912                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00250  Alanine, aspartate and glutamate metabolism
micr00280  Valine, leucine and isoleucine degradation
micr00310  Lysine degradation
micr00410  beta-Alanine metabolism
micr00640  Propanoate metabolism
micr00650  Butanoate metabolism
micr01100  Metabolic pathways
micr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BMW26_12895
   00650 Butanoate metabolism
    BMW26_12895
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMW26_12895
   00280 Valine, leucine and isoleucine degradation
    BMW26_12895
   00310 Lysine degradation
    BMW26_12895
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMW26_12895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:micr01007]
    BMW26_12895
Enzymes [BR:micr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BMW26_12895
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BMW26_12895
    2.6.1.48  5-aminovalerate transaminase
     BMW26_12895
Amino acid related enzymes [BR:micr01007]
 Aminotransferase (transaminase)
  Class III
   BMW26_12895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APH45749
LinkDB All DBs
Position
complement(2685780..2687147)
Genome map
AA seq 455 aa AA seqDB search
MALLDTAAVAVPLGGPDLPQERRLVTDLPGPRSAEILARKADAVAAGVGHTVPVAAVAAG
GGVVVDADGNSLIDLGSGIAVTTVGNAHPKIAAAVAAQAAQFTHTCFMISPYESYIGVAE
ALNRLTPGDFAKKSALFNSGAEAVENAIKIARKHTGRQAVVAFDHGYHGRTNLTMALTAK
SMPYKSGFGPFAPEVYRAPMSYPFRDGLDGAEAAARVILQLEKQIGADNLAAVIIEPIQG
EGGFIVPAEGFLPAIASWSRANGVVFIADEVQTGFARTGHMFASEIFGIEPDLITTAKGI
AGGLPLAAVTGRSEIMDASHAGGLGGTYGGNPIACAAALAAIDVFENDGVIERAREIGEI
LTARLGAMQEKDTRIGDIRGHGAMIAAEFVDPETNAPDAALTSAVAKACVAQGVIVLTCG
TYGNVIRFLPPLSIGDDLLNEGLDVVAAALAATAG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctcgacaccgcagctgttgcagtcccgctcggcggacccgacctcccccag
gagcgtcgtctcgtcaccgaccttcccggcccccgctcggccgagatcctcgcccgcaag
gccgatgccgtcgccgccggcgtcgggcacacggttcccgtcgcggccgtcgccgccggc
gggggagtggtcgtggatgccgacggcaactcgctgatcgacctcggctccggcattgcc
gtgacgaccgtcggcaacgcgcaccccaagatcgccgcagccgtggccgcgcaggccgcg
cagttcacacacacctgcttcatgatctcgccgtacgagtcgtacatcggcgtcgccgaa
gcgctcaaccgcctcactcccggcgacttcgccaagaagagcgccctgttcaactccggc
gccgaggccgtcgagaacgcgatcaagatcgcccgcaagcacaccggtcgccaggccgtc
gtcgccttcgaccacggctaccacggccgcaccaacctcaccatggcgctgaccgcgaag
tcgatgccgtacaagagcggcttcggcccgttcgcccccgaggtgtaccgtgcgccgatg
tcgtacccgttccgcgacggtctcgacggcgcagaggccgccgcccgcgtgatcctgcag
ctcgagaagcagatcggcgccgacaacctcgccgccgtcatcatcgagccgatccaggga
gagggcggcttcatcgtcccggcggagggcttcctcccggcgatcgcctcgtggtcccgc
gcgaacggcgtcgtgttcatcgccgacgaggtgcagaccggcttcgcccgcaccggccac
atgttcgcgagcgagatcttcggcatcgagcccgacctcatcacgaccgccaagggcatc
gcgggcggtctgcccctcgccgccgtcacggggcgctccgagatcatggacgcctcgcac
gcaggcggcctcggcggcacctacggcggaaacccgatcgcctgcgctgcggcgctcgcc
gcgatcgatgtgttcgagaacgacggcgtgatcgagcgcgctcgcgagatcggcgagatc
ctcacggcacgcctcggagccatgcaggagaaggacacccgcatcggagacatccgcggc
cacggcgccatgatcgccgccgagttcgtcgaccccgagaccaacgcgcccgacgccgcc
ctcacctccgcggtcgccaaggcctgcgtcgcgcagggcgtcatcgtcctgacgtgcggc
acctacggcaacgtcatccggttcctcccgccgctctcgatcggcgacgacctcctgaac
gagggcctcgacgtcgtcgcggccgcgctcgccgccaccgcgggctga

DBGET integrated database retrieval system