KEGG   Microbulbifer sp. THAF38: FIU95_07940Help
Entry
FIU95_07940       CDS       T06274                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mict  Microbulbifer sp. THAF38
Brite
KEGG Orthology (KO) [BR:mict00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FIU95_07940 (ahpF)
Enzymes [BR:mict01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FIU95_07940 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like DAO FAD_binding_2 FAD_oxidored Glutaredoxin Thi4 NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase DUF2190 FMO-like
Motif
Other DBs
NCBI-ProteinID: QFT54481
UniProt: A0A5P9EUP7
LinkDB All DBs
Position
complement(1783278..1784828)
Genome map
AA seq 516 aa AA seqDB search
MLDANLKKQLDTYLQNIVKPIEIRVSTDDSQKSKELESLVDEISALSGKISARQGQAKRT
PNMAIAPAGEEPRVSFAGIPLGHEFTSLVLALLQAGGHPSKANPELLEQVRNLKGEFHFE
TYISLSCQNCPDVVQALNLMATLNPNITHEMIDGSLFQDEVEQRNVMAVPAVYLNGEHFG
QGRMSLEEIVSKLDSGAAERKTEELSEKAPYDLLVVGGGPAGAAAAIYAARKGIRTGLVA
ERFGGQVMDTVGIENFISVPYTEGPKLSASLEQHVKEYGVDIITDQRAANLQRNELVDIE
LQSGATLSSRSVILATGARWRELGVPGEAEYRTKGVAYCPHCDGPFFKGRRVAVIGGGNS
GIEAAIDLAGIVEHVTVLEFADKLRADDVLVRKAQQMDNIDIIVNAQTTEVLGDGNKVNG
LAYTDRESGENKKLDLAGIFVQIGLVPNTEFLKETDVEMNRMGEIIINERGATSVPGVYA
AGDATTVPYKQIVISMGAGATAALGAFDYLIRSSVE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcaaacctgaagaagcaactggacacttacctgcagaatatcgtcaagccg
atcgagattcgtgtgtccactgatgacagccagaaatccaaagagctggaatcgctggtc
gatgaaatttccgcgctctctggaaaaatcagcgcacgccaaggtcaggccaagcgtacc
ccgaatatggccatcgctccagcgggtgaagaaccccgtgtaagctttgccggaatccca
ctgggccatgaattcacctctctagtgttggcgttactgcaagcgggcggccatccctcc
aaagcgaacccagaactacttgagcaggtgcgcaatctaaaaggcgaatttcactttgaa
acttacatatcgctttcctgccagaactgcccggatgtggttcaagcactgaacctgatg
gccaccctaaacccgaacatcacccacgagatgatcgatggcagcttgttccaggatgag
gttgagcagcgcaatgtgatggcggtaccagcggtctacctgaacggcgaacatttcggc
caggggagaatgtctctggaagaaatcgtcagtaaactggatagcggcgccgcagaacgc
aaaactgaagaactcagtgaaaaagccccttacgacttactggtagtgggtggtggaccc
gccggtgctgcagcagccatttatgccgcacgcaagggcattcgcacaggcctggtggct
gagcgctttggcggacaggtgatggataccgtgggtatcgaaaactttatctcagtccct
tacaccgaaggtccgaagctttctgccagtctggagcaacacgttaaagagtacggtgta
gatattattaccgatcaacgtgcagccaatttacagcgcaacgagctggtggatatagag
ctgcaaagcggcgctaccctatccagtcgctcagtcatactggccaccggagcccgctgg
agagaactcggcgtgccaggtgaagcagaataccgcactaaaggcgtagcctactgcccc
cactgcgacggccccttctttaaaggcaggcgtgtagcggttattggcggtggcaactcc
ggtattgaggcggccatcgacctggccggtattgtcgagcatgtcaccgtattggaattt
gccgacaagctacgagcagatgacgttttagtacgcaaagctcagcagatggataacatt
gacattatcgtcaacgcccaaaccactgaagtcctaggcgatggtaacaaggtaaatggg
ctcgcctacaccgatcgtgaatctggagaaaacaaaaaactcgatctggcaggaatcttt
gtgcaaattgggttggtacccaatacagagttcctcaaggaaaccgatgtagaaatgaat
cgcatgggagagatcatcatcaacgagcgtggcgcaacttctgtacccggcgtctacgct
gccggcgatgccaccactgtgccttacaagcaaattgtgatttccatgggagccggtgcc
acagcagcattgggcgcatttgattacctgatccgctcctcagtggaataa

DBGET integrated database retrieval system