KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00023Help
Entry
MIP_00023         CDS       T02325                                 

Definition
(GenBank) putative serine/threonine-protein kinase pknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Brite
KEGG Orthology (KO) [BR:mid00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mid01001]
    MIP_00023
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MIP_00023
Protein kinases [BR:mid01001]
 Serine/threonine kinases: Other
  Bacterial family
   MIP_00023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal Haspin_kinase RIO1 ABC1 UL42
Motif
Other DBs
NCBI-ProteinID: AFS11998
UniProt: J9W7J0
LinkDB All DBs
Position
complement(18722..19975)
Genome map
AA seq 417 aa AA seqDB search
MTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKQEFSQDPEFIERFRAEARTTA
MLNHPGIAAVHDYGESQLDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTG
RALQVAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAP
EQALGHDATPSSDVYSLGVVGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPAELPPNVR
ELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQSPPPGRASPAAIPSSPTTRAA
AVSPRSAAPRRSRPTTGGHRPPPARRTFSSGQRALLWAAGVLGALAIIIAVLIVINSRGD
QQQQPPTVTDTGTPPASAPAPTNTPSGSAGMRLEWPDDGTIGMSGFRGGPAGHGTSQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgtctggcagataccgcctgcagcgcctgatcgccaccggcggcatgggtcag
gtctgggaggccgtggacagccgcctgggccgacgcgtcgcggtcaaggtgctcaagcag
gagttctcccaagaccccgagttcatcgagcgcttccgcgctgaggcgcggaccacggcg
atgctcaaccaccccgggatcgcggcggtccacgattacggcgagagccagctggacggg
gagggccgcaccgcctacctggtgatggagctggttaacggcgagccgctgaactcggtg
ctcaaacgcaccggccggctgtccctgcggcacgccctggacatgcttgaacagaccggc
cgcgcgctgcaggtcgcgcacgccgccggtctggtccaccgcgacgtcaagccgggcaac
atcctgatcaccccgaccggccaggtgaagatcaccgacttcggcatcgccaaggccgtc
gacgccgcgccggtgacccagaccggcatggtgatgggcaccgcccaatacatcgcgccc
gaacaggcgctcgggcacgacgccaccccgtccagcgacgtgtactcgctgggagttgtt
ggctacgaggttgtttcgggcaagcggccgttcaccggtgacggcgccctgaccgtggcg
atgaagcacatcaaggaacccccgccgccgctgcccgcggagctgccgcccaacgtgcga
gaactcatcgagatcacgctggtcaagaacccggcgatgcggtaccgcagcgggggaccg
ttcgccgacgccgtcgcggcggtgcgcgccggtcgccgtccgccccgccccagccagtca
ccgcctccgggccgggcctcgccggcggcgataccgtccagcccgacgacccgggcggcc
gcggtgtccccgcgcagcgcggcgccgcgtcgatcccgccccaccaccggcgggcaccgc
ccgcccccggcccggcgcaccttctcgtcggggcagcgcgcgctgctctgggccgccggg
gtactcggcgcgctggcgatcatcatcgcggtgctcatcgtcatcaattcccggggggat
cagcagcaacagcccccgacggtcaccgacaccggcaccccgccggcatcggcgcccgcg
ccgaccaacaccccgagcggttcggcaggcatgcgtctcgagtggccggatgacggcacg
atagggatgtcgggattccgcggcggaccggcgggacacgggacatcgcaatga

DBGET integrated database retrieval system