KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00682Help
Entry
MIP_00682         CDS       T02325                                 

Definition
(GenBank) putative DNA ligase
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFS12464
UniProt: J9W630
LinkDB All DBs
Position
complement(504484..505539)
Genome map
AA seq 351 aa AA seqDB search
MPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPELVAAV
RAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLLALGGD
DYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAKPLDVT
YQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIGAFPMA
ERRRLFAELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPERVVEV
RYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLGEIVPGLGPG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgtcgccgatgctggccaagtcggttcgcgctatcccgccccacgcgtcg
tacgagcccaagtgggacggattcaggtcgatctgtttccgcgacggcgacgacgtcgag
ctgggcagccgcaacgagcggccgatgacccgctactttccggagttggtcgccgcggtc
agggccgagctgccggagcgctgcgtgatcgacggggagatcgtcatcgccaccgaccac
ggcctggacttcgaggcgctgcagcaacgcattcacccggccgactcgcgggtgcggatg
ctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctggcgctcggcggcgac
gactacacccggcggccgttcagcgagcggcgggcggccctggtcgatgcggtgggcgga
tcgggtcgctcgatccatgtcacgcccgcgacgaccgatctgggcaccgcgcagcgatgg
ttcgacgagttcgagggcgccggcctcgatggcgtgatcgccaagcccctggacgtcacc
taccagccggacaagcgggtgatgttcaagatcaagcacgaacggaccgcggactgtgtg
gtcgccggctatcgggtccacaagtccggcgccgacgcgatcgggtcgctgctgctgggg
ctctaccaggacgacgggcagctggcctcggtcggcgtcatcggcgccttcccgatggcc
gagcggcgccgcctgttcgccgaactgcagccgctcgtcaccgacttcgcggaccatccg
tggaactgggccgcccacgaggccggcgagcgaacgccccgcaaaaacgaatactcgcgg
tggaacgccggcaaggacctctcgttcgtgccgctgcggcccgagcgcgtggtcgaggtc
cgctacgaccacatggagggtcggcgctttcgtcataccgcgcagttcaatcggtggcgt
ccggaccgcgacccgcgctcgtgcacctacgaacagctggaacagccggtgacgttcagc
ctcggcgagatcgtgccgggcctcggcccgggctga

DBGET integrated database retrieval system