KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00870Help
Entry
MIP_00870         CDS       T02325                                 

Definition
(GenBank) Putative D-xylulose reductase
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C PI31_Prot_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFS12593
UniProt: J9W931
LinkDB All DBs
Position
complement(630386..631399)
Genome map
AA seq 337 aa AA seqDB search
MRASVLRDGRMVYRDDVPDPIPEAGQVLVGVRACGICGSDLHFAAHGAQVLEMTERAAGG
GGGMHVDLDHDIFMGHEFSAEILEAGPDTETHPPGTLVTSLPVLLSAKGVEPIVYSNSSI
GGYSERMLLSAPLLLPVPNGLDFKHAALTEPMAVGLHAVNKSNVAPGETALVLGCGPIGI
AIVAALRSKGVETIVAADFSPKRRELATTMGAHQTLDPAQGSPFDSVKPAVVFEAVGVPG
IIDDVLLRARPGTRLVVAGVCMQPDTVHPFFAIAKEINVQFVLAYTPDEFGDSLRALADG
DIDVSPLITGEVGLDAVGAAFDDLADPERHCKVLVTP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctcggtgttgcgcgacggtcgcatggtctaccgcgacgacgtgcccgacccg
atccccgaagccgggcaggtgctcgtcggcgtgcgggcatgcggaatctgcggcagcgac
ctgcatttcgccgcccacggcgcccaggtgctggaaatgaccgaacgggcagccggtggc
ggcggtggcatgcacgtcgacctggaccacgacatcttcatgggtcacgaattcagcgcc
gagatactcgaagccggccccgacaccgagacccatccaccgggcaccctggtcacctcg
ctgccggtgctgttgtccgccaagggcgtcgagccaattgtgtacagcaacagttcaatc
ggcggttactccgaacggatgctgttgtccgcgccgctgctgctgcccgtccccaatggc
ctggacttcaaacacgcagcactgaccgaacccatggcggtgggattgcatgccgtcaac
aagtccaacgtcgcgcccggggagacggccctggtactgggctgcggcccgatcgggatc
gccatcgtcgcagcccttcggtccaagggcgtcgaaaccattgtggcggcggacttttcg
ccgaagcgacgggaactcgccaccacgatgggagctcaccagacgctggatccggcgcag
ggctcgcccttcgacagtgtcaagcccgcggtggtgttcgaggccgtcggggtgcccggc
atcatcgacgacgtgctgctccgcgcgcggccgggcacccgactggtggttgccggggtg
tgcatgcaacccgacacagtgcatcccttcttcgcgatcgccaaagagatcaacgtgcag
ttcgtgctcgcctacacccccgacgagttcggcgactcgttgcgcgcgctggccgacggc
gacatcgacgtcagcccgctgatcaccggcgaggtgggcctggatgcggtcggggcggcg
ttcgacgacctggccgaccccgagcggcactgcaaggttctcgtcacgccctga

DBGET integrated database retrieval system